Clone FI17511 Report

Search the DGRC for FI17511

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:175
Well:11
Vector:pOT2
Associated Gene/TranscriptCcs-RB
Protein status:FI17511.pep: gold
Sequenced Size:897

Clone Sequence Records

FI17511.complete Sequence

897 bp assembled on 2011-12-03

GenBank Submission: BT132895.1

> FI17511.complete
TTTGTTTATCATTGTTAGTCGGCACTTTGACCATAAAAATGAGCTCCATT
AAGATCGAATTTGCAGTGCAGATGCGAAGAGGTGACGAATCCTATGCCGG
TGCCCTCCGTTCGGCGCTGGATGGGGTCGGCCAGGTGGAAATTGACACCC
AGGAAGGTCGAGTGATAATCCAAACCCAACGACCTTGGTCAGAGATTCAG
GACAAGATAGAAGCCACAGGTGTCCGGGCCGTACTCTCCGGATTCGGCGG
ACAGTCGGCGGTGGCCCTTATTAACACAACAGGAAGTGTAGTGGACAAGA
CACCAATCCAGGGAGTGGTTCGGTTTACCACCATTACCGCAGACAAGAAG
CCTGGAGTGGTTGTGGATGGCGTTGTGGACGGTCTATCGCCTGGACTGCA
CGGATTACATATTCACGAGAGTGGTGACACTTCCGCAGGTTGCTCGTCGG
TCGGAGAACACTACAATCCCCGCCAGTCGCCACATGGAAGCCCTGCAGCT
GGGGCAGAGGAGCGGCACGCCGGAGATCTTGGCAACATCCGAGCGGATGA
AAACGGCAGGGCCACCTTTAGATTTGTGGATCCAGTGCTAGAGGTCTGGG
ACATAATCGGAAGGGCTGTCGTCCTAACAGCCAATGCCGATGACCTGGGA
CGCGGGGGCAATGATCAGAGCCTGATTGACGGCAACTCTGGGGAAAGGAT
TGCGTGTGGTATAATTGCTCGTTCGGCGGGCATCTTGGAAAACTTTAAGA
GAATCTGTGCATGTGATGGGGTCACACTTTGGGATGAACGCAATAAGCCA
CTGGCTGGCAAGGAGCGCTCACAAAAGCTGTAAACTTGTTTCCATCTTTA
ATCTTGTAAATAAAATTATCTTATCTCTAAAAAAAAAAAAAAAAAAA

FI17511.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6009341..6009987 698..52 3235 100 Minus
chr2R 21145070 chr2R 6009100..6009282 878..696 900 99.5 Minus
chr2R 21145070 chr2R 6010037..6010089 53..1 265 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:56:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10121814..10122460 698..52 3205 99.7 Minus
2R 25286936 2R 10121572..10121755 879..696 920 100 Minus
2R 25286936 2R 10122510..10122562 53..1 265 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10123013..10123659 698..52 3205 99.6 Minus
2R 25260384 2R 10122771..10122954 879..696 920 100 Minus
2R 25260384 2R 10123709..10123761 53..1 265 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:56:24 has no hits.

FI17511.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:57:05 Download gff for FI17511.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6009100..6009280 698..878 99 <- Minus
chr2R 6009342..6009985 54..697 100 <- Minus
chr2R 6010037..6010089 1..53 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-03 15:06:06 Download gff for FI17511.complete
Subject Subject Range Query Range Percent Splice Strand
CCS-RB 1..795 39..833 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:50:59 Download gff for FI17511.complete
Subject Subject Range Query Range Percent Splice Strand
Ccs-RB 1..795 39..833 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:46:52 Download gff for FI17511.complete
Subject Subject Range Query Range Percent Splice Strand
Ccs-RB 1..795 39..833 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-03 15:06:05 Download gff for FI17511.complete
Subject Subject Range Query Range Percent Splice Strand
CCS-RB 1..878 1..878 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:50:59 Download gff for FI17511.complete
Subject Subject Range Query Range Percent Splice Strand
Ccs-RB 13..890 1..878 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:46:52 Download gff for FI17511.complete
Subject Subject Range Query Range Percent Splice Strand
Ccs-RB 13..890 1..878 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:57:05 Download gff for FI17511.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10121573..10121753 698..878 100 <- Minus
2R 10121815..10122458 54..697 99 <- Minus
2R 10122510..10122562 1..53 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:57:05 Download gff for FI17511.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10121573..10121753 698..878 100 <- Minus
2R 10121815..10122458 54..697 99 <- Minus
2R 10122510..10122562 1..53 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:57:05 Download gff for FI17511.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10121573..10121753 698..878 100 <- Minus
2R 10121815..10122458 54..697 99 <- Minus
2R 10122510..10122562 1..53 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:50:59 Download gff for FI17511.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6010015..6010067 1..53 100   Minus
arm_2R 6009078..6009258 698..878 100 <- Minus
arm_2R 6009320..6009963 54..697 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:46:11 Download gff for FI17511.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10123014..10123657 54..697 99 <- Minus
2R 10123709..10123761 1..53 100   Minus
2R 10122772..10122952 698..878 100 <- Minus

FI17511.hyp Sequence

Translation from 2 to 832

> FI17511.hyp
CLSLLVGTLTIKMSSIKIEFAVQMRRGDESYAGALRSALDGVGQVEIDTQ
EGRVIIQTQRPWSEIQDKIEATGVRAVLSGFGGQSAVALINTTGSVVDKT
PIQGVVRFTTITADKKPGVVVDGVVDGLSPGLHGLHIHESGDTSAGCSSV
GEHYNPRQSPHGSPAAGAEERHAGDLGNIRADENGRATFRFVDPVLEVWD
IIGRAVVLTANADDLGRGGNDQSLIDGNSGERIACGIIARSAGILENFKR
ICACDGVTLWDERNKPLAGKERSQKL*

FI17511.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
Ccs-PB 264 CG17753-PB 1..264 13..276 1360 100 Plus
Ccs-PC 258 CG17753-PC 3..258 21..276 1315 98.8 Plus
Sod-PD 167 CG11793-PD 5..162 86..238 284 42.5 Plus
Sod-PA 153 CG11793-PA 9..148 102..238 281 44.4 Plus
Sod3-PA 181 CG9027-PA 39..178 98..238 275 43.8 Plus

FI17511.pep Sequence

Translation from 2 to 832

> FI17511.pep
CLSLLVGTLTIKMSSIKIEFAVQMRRGDESYAGALRSALDGVGQVEIDTQ
EGRVIIQTQRPWSEIQDKIEATGVRAVLSGFGGQSAVALINTTGSVVDKT
PIQGVVRFTTITADKKPGVVVDGVVDGLSPGLHGLHIHESGDTSAGCSSV
GEHYNPRQSPHGSPAAGAEERHAGDLGNIRADENGRATFRFVDPVLEVWD
IIGRAVVLTANADDLGRGGNDQSLIDGNSGERIACGIIARSAGILENFKR
ICACDGVTLWDERNKPLAGKERSQKL*

FI17511.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11145-PA 263 GF11145-PA 1..263 13..276 1190 84.8 Plus
Dana\GF24570-PA 153 GF24570-PA 14..148 103..238 275 46 Plus
Dana\GF12396-PA 210 GF12396-PA 36..179 102..246 265 42.6 Plus
Dana\GF18703-PA 124 GF18703-PA 14..119 134..238 219 45.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25230-PA 264 GG25230-PA 1..264 13..276 1279 95.8 Plus
Dere\Sod-PA 153 GG13936-PA 28..148 119..238 272 48 Plus
Dere\GG22650-PA 181 GG22650-PA 28..178 88..238 270 43.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19972-PA 285 GH19972-PA 27..285 17..276 1033 79.6 Plus
Dgri\GH14640-PA 153 GH14640-PA 28..148 119..238 289 49.6 Plus
Dgri\GH20507-PA 181 GH20507-PA 39..178 98..238 253 43.1 Plus
Dgri\GH11755-PA 181 GH11755-PA 39..178 98..238 253 43.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
Ccs-PB 264 CG17753-PB 1..264 13..276 1360 100 Plus
Ccs-PC 258 CG17753-PC 3..258 21..276 1315 98.8 Plus
Sod1-PD 167 CG11793-PD 5..162 86..238 284 42.5 Plus
Sod1-PA 153 CG11793-PA 9..148 102..238 281 44.4 Plus
Sod3-PD 217 CG9027-PD 39..186 98..246 277 42.1 Plus
Sod3-PF 181 CG9027-PF 39..178 98..238 275 43.8 Plus
Sod3-PA 181 CG9027-PA 39..178 98..238 275 43.8 Plus
Sod3-PB 181 CG9027-PB 39..178 98..238 275 43.8 Plus
Sod3-PE 243 CG9027-PE 39..178 98..238 275 43.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20259-PA 236 GI20259-PA 1..219 13..232 812 76.8 Plus
Dmoj\GI11624-PA 153 GI11624-PA 14..148 103..238 278 47.5 Plus
Dmoj\GI21051-PA 181 GI21051-PA 39..178 98..238 257 43.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20081-PA 263 GL20081-PA 1..263 13..276 1075 79.9 Plus
Dper\Sod-PA 152 GL22843-PA 13..147 103..238 287 46 Plus
Dper\GL10397-PA 277 GL10397-PA 39..178 98..238 250 42.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14646-PA 263 GA14646-PA 1..263 13..276 1075 79.9 Plus
Dpse\Sod-PA 152 GA11202-PA 13..147 103..238 287 46 Plus
Dpse\GA30465-PB 181 GA30465-PB 39..178 98..238 255 42.4 Plus
Dpse\GA30465-PA 258 GA30465-PA 39..178 98..238 253 42.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20549-PA 264 GM20549-PA 1..264 13..276 1342 97.3 Plus
Dsec\Sod-PA 153 GM24771-PA 28..148 119..238 270 48 Plus
Dsec\GM20432-PA 181 GM20432-PA 39..178 98..238 263 43.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD26004-PA 264 GD26004-PA 1..264 13..276 1353 98.1 Plus
Dsim\Sod-PA 153 GD12822-PA 28..148 119..238 270 48 Plus
Dsim\GD25903-PA 181 GD25903-PA 39..178 98..238 270 44.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20212-PA 263 GJ20212-PA 1..263 13..276 1062 79.9 Plus
Dvir\Sod-PA 153 GJ11304-PA 28..148 119..238 274 48.8 Plus
Dvir\GJ21975-PA 181 GJ21975-PA 39..178 98..238 258 43.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23033-PA 252 GK23033-PA 1..252 13..276 893 68.8 Plus
Dwil\Sod-PA 153 GK20556-PA 28..148 119..238 278 48.8 Plus
Dwil\GK21886-PA 181 GK21886-PA 39..178 98..238 266 43.1 Plus
Dwil\GK13564-PA 157 GK13564-PA 36..153 98..216 201 41 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21764-PA 264 GE21764-PA 1..264 13..276 1267 95.1 Plus
Dyak\GE13524-PA 181 GE13524-PA 39..178 98..238 269 43.1 Plus
Dyak\Sod-PA 153 GE20235-PA 28..148 119..238 267 47.2 Plus