Clone FI17821 Report

Search the DGRC for FI17821

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:178
Well:21
Vector:pOT2
Associated Gene/TranscriptCG3760-RB
Protein status:FI17821.pep: gold
Sequenced Size:1120

Clone Sequence Records

FI17821.complete Sequence

1120 bp assembled on 2011-12-09

GenBank Submission: BT132910.1

> FI17821.complete
GGCGTGCAGAGTTGTTCTCCAAATTTCCTGTCGCGAATTTTATTCATTTA
TAATTAATTGCAAGCCATGGCCGAACTGGACGATTTCTTCGCGAAAAAGG
ACAAGAAGAAGTCCAAGAACAAGACTAAGTTCGTGACCGCCGACGAGATG
GTGAAGAACCTGGAGGACGGCACCAAGCGCGAGGTGGTCAAGCCCAAAAA
ACCTGAGGTAGCCGCTGGCGGCGTGGCAGTAGTAGGCGAAAACGAGAATA
GCGGCACCAAGGTGCCAGAGTCCGCCCCGCCCGTCGAGGAGGAATGGAAG
GAGTTCGAGGAGGAGCAGCGCAAGGACTACAGTGGCTTAAAGATCGGCCA
GCTGAGCACCATAACTGCCCAGGAAAGTTCCGAGTCGCAAGCTGCTCGAG
TGCCCTCTGCCCCGGACGGCGGCAACTACAATGAGGACGATGAGGACAGC
AATGGGTATGACAACGCGGACGTAAACAAGGAGCGCGTCGGCCACGGACC
CTGGAAAAAAGTTGTCCCAGCCGAGGAGGTAATGCAGATTCCGGTGCCCG
TGGAGGTGGAAAAGCACTCGTCCAAGACCTACGTTTCACCCGCGCTACGA
TACAGCCAGCAGGCCGGAAGTGGACTGGGAGGCGGCCCTACTGGGGGGGC
ATTGCGTCCACGACGCGCCGCCCCCGACATCACCAATACCGAGTTTTTCC
CAACACTAAGTGCGGCGCGTCCGGAGGAACAGCGCAAGAAGAAAAACGAA
CCCGCCTTCGAAGAAGTCCGTCACGGAAGCCGGTTCCAGCGTGTTCAGGA
GTCCACGGCTGCCCCGGTGGCGGCCTCCAACCGATTCCAGTCGCTTGACG
ACGAAGCAAGCTAGGTCAGCCCACGCCAACGGTGCTGTTGCTGGCCACTT
GAACCGCTATCTACCACAGTGTCCGCTGCCGAGCTCAAGCCATCCAAAGG
TTCTATGCCAGCACATGCAGATTTTCTAGGCTTTTTGATTCATATAAACC
ACCACTGCTACTCTTACCCTAAACCACAAACTACTATTGTTCATTTCGTT
TTGCATTTTGAAAAATGGATTAATGTAATACAATACGAATAATACCCAAA
AAAAAAAAAAAAAAAAAAAA

FI17821.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20825225..20825715 607..1097 2455 100 Plus
chr2R 21145070 chr2R 20824349..20824627 1..279 1395 100 Plus
chr2R 21145070 chr2R 20824924..20825171 359..606 1210 99.2 Plus
chr2R 21145070 chr2R 20824713..20824796 279..362 420 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24939271..24939762 607..1098 2415 99.4 Plus
2R 25286936 2R 24938395..24938673 1..279 1380 99.6 Plus
2R 25286936 2R 24938970..24939217 359..606 1210 99.2 Plus
2R 25286936 2R 24938759..24938842 279..362 420 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24940470..24940961 607..1098 2415 99.3 Plus
2R 25260384 2R 24939594..24939872 1..279 1380 99.6 Plus
2R 25260384 2R 24940169..24940416 359..606 1210 99.1 Plus
2R 25260384 2R 24939958..24940041 279..362 420 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:59:23 has no hits.

FI17821.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:00:27 Download gff for FI17821.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20824349..20824627 1..279 100 -> Plus
chr2R 20824714..20824796 280..362 100 -> Plus
chr2R 20824928..20825171 363..606 99 -> Plus
chr2R 20825225..20825715 607..1097 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-12-09 08:49:16 Download gff for FI17821.complete
Subject Subject Range Query Range Percent Splice Strand
CG3760-RB 1..798 67..864 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:51:22 Download gff for FI17821.complete
Subject Subject Range Query Range Percent Splice Strand
CG3760-RB 1..798 67..864 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:47:33 Download gff for FI17821.complete
Subject Subject Range Query Range Percent Splice Strand
CG3760-RB 1..798 67..864 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-12-09 08:49:15 Download gff for FI17821.complete
Subject Subject Range Query Range Percent Splice Strand
CG3760-RB 57..1153 1..1097 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:51:22 Download gff for FI17821.complete
Subject Subject Range Query Range Percent Splice Strand
CG3760-RB 24..1120 1..1097 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:47:33 Download gff for FI17821.complete
Subject Subject Range Query Range Percent Splice Strand
CG3760-RB 24..1120 1..1097 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:00:27 Download gff for FI17821.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24938974..24939217 363..606 99 -> Plus
2R 24938395..24938673 1..279 99 -> Plus
2R 24938760..24938842 280..362 100 -> Plus
2R 24939271..24939761 607..1097 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:00:27 Download gff for FI17821.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24938974..24939217 363..606 99 -> Plus
2R 24938395..24938673 1..279 99 -> Plus
2R 24938760..24938842 280..362 100 -> Plus
2R 24939271..24939761 607..1097 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:00:27 Download gff for FI17821.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24938974..24939217 363..606 99 -> Plus
2R 24938395..24938673 1..279 99 -> Plus
2R 24938760..24938842 280..362 100 -> Plus
2R 24939271..24939761 607..1097 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:51:22 Download gff for FI17821.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20825918..20826196 1..279 99 -> Plus
arm_2R 20826283..20826365 280..362 100 -> Plus
arm_2R 20826497..20826740 363..606 99 -> Plus
arm_2R 20826794..20827284 607..1097 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:52:10 Download gff for FI17821.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24939612..24939890 1..279 99 -> Plus
2R 24939977..24940059 280..362 100 -> Plus
2R 24940191..24940434 363..606 99 -> Plus
2R 24940488..24940978 607..1097 99   Plus

FI17821.hyp Sequence

Translation from 66 to 863

> FI17821.hyp
MAELDDFFAKKDKKKSKNKTKFVTADEMVKNLEDGTKREVVKPKKPEVAA
GGVAVVGENENSGTKVPESAPPVEEEWKEFEEEQRKDYSGLKIGQLSTIT
AQESSESQAARVPSAPDGGNYNEDDEDSNGYDNADVNKERVGHGPWKKVV
PAEEVMQIPVPVEVEKHSSKTYVSPALRYSQQAGSGLGGGPTGGALRPRR
AAPDITNTEFFPTLSAARPEEQRKKKNEPAFEEVRHGSRFQRVQESTAAP
VAASNRFQSLDDEAS*

FI17821.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG3760-PC 265 CG3760-PC 1..265 1..265 1367 100 Plus
CG3760-PB 265 CG3760-PB 1..265 1..265 1367 100 Plus
CG3760-PD 264 CG3760-PD 1..264 1..265 1350 99.6 Plus
CG3760-PA 271 CG3760-PA 1..271 1..265 1350 97.8 Plus
CG4892-PA 190 CG4892-PA 28..185 67..217 144 29.4 Plus

FI17821.pep Sequence

Translation from 66 to 863

> FI17821.pep
MAELDDFFAKKDKKKSKNKTKFVTADEMVKNLEDGTKREVVKPKKPEVAA
GGVAVVGENENSGTKVPESAPPVEEEWKEFEEEQRKDYSGLKIGQLSTIT
AQESSESQAARVPSAPDGGNYNEDDEDSNGYDNADVNKERVGHGPWKKVV
PAEEVMQIPVPVEVEKHSSKTYVSPALRYSQQAGSGLGGGPTGGALRPRR
AAPDITNTEFFPTLSAARPEEQRKKKNEPAFEEVRHGSRFQRVQESTAAP
VAASNRFQSLDDEAS*

FI17821.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13352-PA 264 GF13352-PA 1..264 1..265 826 78.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23019-PA 271 GG23019-PA 1..271 1..265 1059 93 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19835-PA 281 GH19835-PA 1..279 1..264 627 67.3 Plus
Dgri\GH10398-PA 217 GH10398-PA 1..217 1..224 196 31.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG3760-PC 265 CG3760-PC 1..265 1..265 1367 100 Plus
CG3760-PB 265 CG3760-PB 1..265 1..265 1367 100 Plus
CG3760-PD 264 CG3760-PD 1..264 1..265 1350 99.6 Plus
CG3760-PA 271 CG3760-PA 1..271 1..265 1350 97.8 Plus
CG4892-PA 190 CG4892-PA 28..185 67..217 144 29.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20423-PA 268 GI20423-PA 1..266 1..264 649 69.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11200-PA 272 GL11200-PA 1..270 1..264 745 75.9 Plus
Dper\GL21043-PA 232 GL21043-PA 1..226 1..218 155 29.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17668-PA 272 GA17668-PA 1..270 1..264 745 75.9 Plus
Dpse\GA18506-PA 232 GA18506-PA 1..226 1..218 161 30 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11915-PA 271 GM11915-PA 1..271 1..265 1045 96.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20097-PA 275 GJ20097-PA 1..273 1..264 527 66.2 Plus
Dvir\GJ18054-PA 238 GJ18054-PA 1..232 1..218 188 30.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20912-PA 271 GK20912-PA 24..269 23..264 643 69.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14456-PA 271 GE14456-PA 1..271 1..265 1026 94.1 Plus