Clone FI19808 Report

Search the DGRC for FI19808

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:198
Well:8
Vector:pOT2
Associated Gene/TranscriptCG34134-RA
Protein status:FI19808.pep: gold
Sequenced Size:504

Clone Sequence Records

FI19808.complete Sequence

504 bp assembled on 2012-03-21

GenBank Submission: BT133331.1

> FI19808.complete
TCGTCGCAATTGAACACCACACCATGCGCGCTCCAGAGTGGATGAGCAAT
GAAATGGCGCGCCTCACATCAAGGCTCGAGCGCTACAAGCCAACGGGCAG
TGGATATAATCGCATCCAGTCGATTCGACTGTCCAAAAGCGTTACCCAAA
TGCTGAACAATCCAATGCCTCCGGCACCAGCCGCTGCCACCGCCAGATCG
CAGCCAGAAAGCTCCTTCACAACGCCGCGACGGCGCGGTGTCCTTAGTCG
CACTCAATCGGAATGGGAGGAGGTGTATCCTGTCGTCAAGTTCAATCGTC
AAGGGAGCAGCGAGAGCGACATAAGTGAGGATAACGAACTGAGGTTCACC
CACTATAGAAACTGTGCCACGCGTATTCCTTGAGTGGATATACCATCTTT
AATCTTTTTTGATAATCTATAAATTTGTATCAGAATTAAGTGAAAACAAT
AAAACAACAAACACTCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

FI19808.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8189290..8189756 467..1 2320 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8190290..8190763 474..1 2370 100 Minus
Blast to na_te.dros performed on 2019-03-15 13:05:14 has no hits.

FI19808.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:05:58 Download gff for FI19808.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8189290..8189756 1..467 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2012-03-21 19:32:40 Download gff for FI19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34134-RA 1..360 24..383 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:57:19 Download gff for FI19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34134-RA 1..360 24..383 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:21:33 Download gff for FI19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34134-RA 1..360 24..383 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-21 19:32:39 Download gff for FI19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34134-RA 19..485 1..467 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:57:19 Download gff for FI19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34134-RA 19..485 1..467 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:21:33 Download gff for FI19808.complete
Subject Subject Range Query Range Percent Splice Strand
CG34134-RA 19..485 1..467 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:05:58 Download gff for FI19808.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8190297..8190763 1..467 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:05:58 Download gff for FI19808.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8190297..8190763 1..467 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:05:58 Download gff for FI19808.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8190297..8190763 1..467 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:57:19 Download gff for FI19808.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8190297..8190763 1..467 100   Minus

FI19808.pep Sequence

Translation from 2 to 382

> FI19808.pep
VAIEHHTMRAPEWMSNEMARLTSRLERYKPTGSGYNRIQSIRLSKSVTQM
LNNPMPPAPAAATARSQPESSFTTPRRRGVLSRTQSEWEEVYPVVKFNRQ
GSSESDISEDNELRFTHYRNCATRIP*

FI19808.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14406-PA 113 GF14406-PA 1..113 8..126 435 76.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23472-PA 119 GG23472-PA 1..119 8..126 537 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11505-PA 134 GH11505-PA 1..133 8..125 414 66.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG34134-PA 119 CG34134-PA 1..119 8..126 620 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17001-PA 128 GI17001-PA 1..127 8..125 443 69.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26474-PA 109 GL26474-PA 1..109 18..126 434 76.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:03:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28877-PA 109 GA28877-PA 1..109 18..126 434 76.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:03:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13155-PA 119 GM13155-PA 1..119 8..126 610 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22436-PA 119 GD22436-PA 1..119 8..126 620 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24259-PA 122 GJ24259-PA 1..121 8..125 446 71.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23742-PA 127 GK23742-PA 1..127 8..126 487 74.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11161-PA 119 GE11161-PA 1..119 8..126 458 94.1 Plus

FI19808.hyp Sequence

Translation from 2 to 382

> FI19808.hyp
VAIEHHTMRAPEWMSNEMARLTSRLERYKPTGSGYNRIQSIRLSKSVTQM
LNNPMPPAPAAATARSQPESSFTTPRRRGVLSRTQSEWEEVYPVVKFNRQ
GSSESDISEDNELRFTHYRNCATRIP*

FI19808.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG34134-PA 119 CG34134-PA 1..119 8..126 620 100 Plus