Clone FI19906 Report

Search the DGRC for FI19906

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:199
Well:6
Vector:pOTB7
Associated Gene/TranscriptCG34120-RB
Protein status:FI19906.pep: gold
Sequenced Size:1013

Clone Sequence Records

FI19906.complete Sequence

1013 bp assembled on 2012-03-21

GenBank Submission: BT133335.1

> FI19906.complete
CCTCGTGCCGGTTTTATTTGTCACCTTGACTTTTCGATTGAAGATATTTT
TATTATTTATGTATTTTGGCCAGATATAAAGAACTATGCTAAAAATTTTC
AGTCATTTCGATTTTCCCTTTGCAGACGACAAAAATGCCCGAGTGATCAA
GCCAACACAGCGATCGCCAGTGGGACAAGTGACAGGAAACGGAGGAGCCA
GCCGTAATGAGGGTGCACCTGAATGGTCGCGAGGTCCGGGAGCTGTTGCG
AAAGGATTTGCTGGTGCGATGGCGACAGAAAGGGCTGAGTCTGATCCTGT
TGGCCTGGCCAGTGATGGTCTTTATGCTGCTCTATCTGATCCGTCTGAAG
TACGGATCGGAGGAGTTGGAGGCCTGCCAGTATCCCACTCGCCTGCTGCC
CACCAAGAACCAAGTGGTTCCCGCTGCCTTCTCCTACATATGCAGTATTG
AGAACCGCTGCCAGCCGGCGCATCCTTACGAGGAGTATTCCCATTGGAAG
GAGGCGCCACTGCACTCCGTGATCGATGTGGTCAACGCGTTCGTAACCGA
CGAACGGCTCCACAAGGCCGTCGTGGAGCTGGCCGAAAAGGCCAACTTTG
TGTCGGCCATAACTACATTGATCACCAGTGATCGGTTCGACATCATACGA
AGTAACATAAGTGAAATAATTTCCCTCGTGCCCGAAATCGAACGACGAAT
GAACTACAGCTTCGACATCAAACATTTGTTTTCGAATCGCGAAACCTTCG
TGAAGTTGGGCGTTCTTTTGTGTGGTCATCCGTTTCCCAATACCGATACT
ATACCGTTGGTCAATGAAATCCTGGAATCCGAGGACTTTAGCCAGGCCAA
CGATGCAGAGATCGATGCAATGCCCACCCGTCGTCGTCGTCGATACGAAG
ATCTTCCCACGGACTGGAGGCCAAGTGAGCATGACCAAATATTTTTTAAT
ATTTGAAAAGCTTCCTAATTACATAACAAATTAAAGTCTTAAAAAAAAAA
AAAAAAAAAAAAA

FI19906.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20997412..20997909 11..508 2490 100 Plus
chrX 22417052 chrX 20997962..20998108 509..655 720 99.3 Plus
chrX 22417052 chrX 20998485..20998625 736..876 705 100 Plus
chrX 22417052 chrX 20998705..20998818 877..990 570 100 Plus
chrX 22417052 chrX 20998344..20998427 652..735 420 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21132255..21132752 11..508 2490 100 Plus
X 23542271 X 21132805..21132951 509..655 720 99.3 Plus
X 23542271 X 21133328..21133468 736..876 705 100 Plus
X 23542271 X 21133548..21133663 877..992 580 100 Plus
X 23542271 X 21133187..21133270 652..735 420 100 Plus
Blast to na_te.dros performed 2019-03-15 13:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 6838..6904 80..14 119 64.2 Minus
Tc1 1666 Tc1 TC1 1666bp 1539..1603 32..94 112 67.7 Plus

FI19906.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:05:48 Download gff for FI19906.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20997412..20997909 11..508 100 -> Plus
chrX 20997962..20998104 509..651 99 -> Plus
chrX 20998344..20998427 652..735 100 -> Plus
chrX 20998485..20998625 736..876 100 -> Plus
chrX 20998705..20998818 877..990 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2012-03-21 19:20:41 Download gff for FI19906.complete
Subject Subject Range Query Range Percent Splice Strand
CG34120-RB 1..750 207..956 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:57:06 Download gff for FI19906.complete
Subject Subject Range Query Range Percent Splice Strand
CG34120-RB 1..750 207..956 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:21:16 Download gff for FI19906.complete
Subject Subject Range Query Range Percent Splice Strand
CG34120-RB 1..750 207..956 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-21 19:20:41 Download gff for FI19906.complete
Subject Subject Range Query Range Percent Splice Strand
CG34120-RB 1..978 11..988 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:57:06 Download gff for FI19906.complete
Subject Subject Range Query Range Percent Splice Strand
CG34120-RB 1..980 11..990 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:21:16 Download gff for FI19906.complete
Subject Subject Range Query Range Percent Splice Strand
CG34120-RB 1..980 11..990 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:05:48 Download gff for FI19906.complete
Subject Subject Range Query Range Percent Splice Strand
X 21132255..21132752 11..508 100 -> Plus
X 21132805..21132947 509..651 99 -> Plus
X 21133187..21133270 652..735 100 -> Plus
X 21133328..21133468 736..876 100 -> Plus
X 21133548..21133661 877..990 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:05:48 Download gff for FI19906.complete
Subject Subject Range Query Range Percent Splice Strand
X 21132255..21132752 11..508 100 -> Plus
X 21132805..21132947 509..651 99 -> Plus
X 21133187..21133270 652..735 100 -> Plus
X 21133328..21133468 736..876 100 -> Plus
X 21133548..21133661 877..990 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:05:48 Download gff for FI19906.complete
Subject Subject Range Query Range Percent Splice Strand
X 21132255..21132752 11..508 100 -> Plus
X 21132805..21132947 509..651 99 -> Plus
X 21133187..21133270 652..735 100 -> Plus
X 21133328..21133468 736..876 100 -> Plus
X 21133548..21133661 877..990 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:57:06 Download gff for FI19906.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 21003282..21003779 11..508 100 -> Plus
arm_X 21003832..21003974 509..651 99 -> Plus
arm_X 21004214..21004297 652..735 100 -> Plus
arm_X 21004355..21004495 736..876 100 -> Plus
arm_X 21004575..21004688 877..990 100   Plus

FI19906.pep Sequence

Translation from 206 to 955

> FI19906.pep
MRVHLNGREVRELLRKDLLVRWRQKGLSLILLAWPVMVFMLLYLIRLKYG
SEELEACQYPTRLLPTKNQVVPAAFSYICSIENRCQPAHPYEEYSHWKEA
PLHSVIDVVNAFVTDERLHKAVVELAEKANFVSAITTLITSDRFDIIRSN
ISEIISLVPEIERRMNYSFDIKHLFSNRETFVKLGVLLCGHPFPNTDTIP
LVNEILESEDFSQANDAEIDAMPTRRRRRYEDLPTDWRPSEHDQIFFNI*

FI19906.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21717-PA 248 GF21717-PA 1..241 1..242 1107 84.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19711-PA 244 GG19711-PA 1..242 1..242 1244 96.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11841-PA 1997 GH11841-PA 7..234 9..235 905 72.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG34120-PB 249 CG34120-PB 1..249 1..249 1300 100 Plus
CG34120-PC 1997 CG34120-PC 1..242 1..242 1250 98.8 Plus
CG34120-PE 1998 CG34120-PE 1..242 1..242 1250 98.8 Plus
CG34120-PD 1981 CG34120-PD 1..234 1..233 1165 97 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14316-PA 1961 GI14316-PA 6..234 8..235 928 72.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16402-PA 1967 GL16402-PA 1..236 1..235 1004 77.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22369-PA 284 GA22369-PA 1..254 1..241 999 73.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23065-PA 253 GM23065-PA 1..249 1..249 1304 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17517-PA 253 GD17517-PA 1..249 1..249 1304 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19374-PA 1218 GJ19374-PA 7..222 9..224 916 76.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19938-PA 248 GK19938-PA 1..248 1..246 981 75.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17909-PA 306 GE17909-PA 1..249 1..249 1288 96.4 Plus

FI19906.hyp Sequence

Translation from 206 to 955

> FI19906.hyp
MRVHLNGREVRELLRKDLLVRWRQKGLSLILLAWPVMVFMLLYLIRLKYG
SEELEACQYPTRLLPTKNQVVPAAFSYICSIENRCQPAHPYEEYSHWKEA
PLHSVIDVVNAFVTDERLHKAVVELAEKANFVSAITTLITSDRFDIIRSN
ISEIISLVPEIERRMNYSFDIKHLFSNRETFVKLGVLLCGHPFPNTDTIP
LVNEILESEDFSQANDAEIDAMPTRRRRRYEDLPTDWRPSEHDQIFFNI*

FI19906.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG34120-PB 249 CG34120-PB 1..249 1..249 1300 100 Plus
CG34120-PC 1997 CG34120-PC 1..242 1..242 1250 98.8 Plus
CG34120-PE 1998 CG34120-PE 1..242 1..242 1250 98.8 Plus
CG34120-PD 1981 CG34120-PD 1..234 1..233 1165 97 Plus