Clone FI20112 Report

Search the DGRC for FI20112

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:201
Well:12
Vector:pFlc-1
Associated Gene/TranscriptNurf-38-RA
Protein status:FI20112.pep: gold
Sequenced Size:1194

Clone Sequence Records

FI20112.complete Sequence

1194 bp assembled on 2012-04-17

GenBank Submission: BT133451.1

> FI20112.complete
GATAGACTCAACTCAGGGCTGAAGAAAATGTTGGCGAAAATTACAAGGAG
TTCATTTTACGCTTCACGTGCGGTTGGTCGCTTGTCCGGCTCGATTCCAA
CGTCACCAGCGGCCCTTGCCAGCAATTGCAGATATATTCAGATAGAACGG
AAGCGCACGAAATCACACGAGATGGCTCTGTACGAAACCGTTGAGAAGGG
CGCTAAGAATTCGCCGAGCTACAGCCTGTATTTCAAAAACAAGTGCGGCA
ATGTCATCTCGCCGATGCACGACATTCCACTGTACGCCAACGAGGAGAAA
ACTATCTACAACATGGTGGTGGAGGTGCCACGTTGGACCAACGCGAAAAT
GGAGATTAGCTTGAAGACCCCTATGAATCCCATCAAGCAGGACATCAAGA
AGGGTAAGCTGCGGTTCGTGGCCAACTGCTTCCCGCACAAGGGCTACATC
TGGAACTACGGAGCCCTGCCCCAGACCTGGGAAAACCCCGACCACATCGA
GCCCTCCACCGGCTGCAAGGGTGACAACGATCCCATCGATGTCATCGAGA
TTGGCTACCGAGTGGCTAAGCGCGGCGACGTGCTGAAGGTCAAGGTGCTG
GGCACCATTGCCTTGATTGACGAGGGCGAAACCGACTGGAAGATAATCGC
CATCGATGTGAACGATCCGTTGGCCTCGAAAGTCAATGATATCGCCGATG
TGGACCAGTACTTCCCGGGTCTGCTTCGTGCCACCGTTGAGTGGTTCAAG
ATCTACAAGATCCCCGATGGCAAGCCTGAGAATCAGTTTGCTTTCAACGG
CGATGCCAAGAATGCGGACTTTGCCAACACCATCATTGCCGAGACCCACA
AGTTCTGGCAGAACTTGGTGCACCAGAGCCCCGCATCCGGGTCCATCTCC
ACCACCAACATCACCAACCGCAACTCGGAGCACGTCATTCCCAAGGAGGA
GGCCGAGAAGATACTGGCCGAGGCCCCCGATGGCGGCCAGGTCGAGGAGG
TGTCTGATACAGTCGACACTTGGCATTTCATTCATCTCAAGTGAGATGTT
CTCCTGGGCTGATTCCATCACAAGATCCATGATCTATCTGTAGTCCAATC
GAATCGAAAATGCTTGCACTTGTGAATTATTAATACTGAAATATTATCGT
ACGTTGAATAAAGTTTTGCACCGCAACCAAAAAAAAAAAAAAAA

FI20112.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20445760..20446157 750..353 1975 99.7 Minus
chr2R 21145070 chr2R 20446783..20447017 235..1 1175 100 Minus
chr2R 21145070 chr2R 20444899..20445065 1176..1010 820 99.4 Minus
chr2R 21145070 chr2R 20445553..20445706 902..749 770 100 Minus
chr2R 21145070 chr2R 20446222..20446340 354..236 595 100 Minus
chr2R 21145070 chr2R 20445385..20445494 1012..903 550 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24559830..24560227 750..353 1990 100 Minus
2R 25286936 2R 24560853..24561087 235..1 1175 100 Minus
2R 25286936 2R 24558964..24559135 1181..1010 845 99.4 Minus
2R 25286936 2R 24559623..24559776 902..749 770 100 Minus
2R 25286936 2R 24560292..24560410 354..236 595 100 Minus
2R 25286936 2R 24559455..24559564 1012..903 550 100 Minus
Blast to na_te.dros performed on 2019-03-15 13:48:13 has no hits.

FI20112.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:49:05 Download gff for FI20112.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20444897..20445062 1013..1178 98 <- Minus
chr2R 20445385..20445494 903..1012 100 <- Minus
chr2R 20445553..20445704 751..902 100 <- Minus
chr2R 20445760..20446155 355..750 99 <- Minus
chr2R 20446222..20446340 236..354 100 <- Minus
chr2R 20446783..20447017 1..235 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2012-04-17 17:25:45 Download gff for FI20112.complete
Subject Subject Range Query Range Percent Splice Strand
Nurf-38-RA 1..1017 28..1044 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:13:05 Download gff for FI20112.complete
Subject Subject Range Query Range Percent Splice Strand
Nurf-38-RA 1..1017 28..1044 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:41:25 Download gff for FI20112.complete
Subject Subject Range Query Range Percent Splice Strand
Nurf-38-RA 1..1017 28..1044 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-17 17:25:45 Download gff for FI20112.complete
Subject Subject Range Query Range Percent Splice Strand
Nurf-38-RA 1..1178 1..1178 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:13:05 Download gff for FI20112.complete
Subject Subject Range Query Range Percent Splice Strand
Nurf-38-RA 1..1178 1..1178 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:41:25 Download gff for FI20112.complete
Subject Subject Range Query Range Percent Splice Strand
Nurf-38-RA 1..1178 1..1178 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:49:05 Download gff for FI20112.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24559455..24559564 903..1012 100 <- Minus
2R 24559623..24559774 751..902 100 <- Minus
2R 24559830..24560225 355..750 100 <- Minus
2R 24560292..24560410 236..354 100 <- Minus
2R 24558967..24559132 1013..1178 99 <- Minus
2R 24560853..24561087 1..235 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:49:05 Download gff for FI20112.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24559455..24559564 903..1012 100 <- Minus
2R 24559623..24559774 751..902 100 <- Minus
2R 24559830..24560225 355..750 100 <- Minus
2R 24560292..24560410 236..354 100 <- Minus
2R 24558967..24559132 1013..1178 99 <- Minus
2R 24560853..24561087 1..235 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:49:05 Download gff for FI20112.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24559455..24559564 903..1012 100 <- Minus
2R 24559623..24559774 751..902 100 <- Minus
2R 24559830..24560225 355..750 100 <- Minus
2R 24560292..24560410 236..354 100 <- Minus
2R 24558967..24559132 1013..1178 99 <- Minus
2R 24560853..24561087 1..235 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:13:05 Download gff for FI20112.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20446490..20446655 1013..1178 99 <- Minus
arm_2R 20446978..20447087 903..1012 100 <- Minus
arm_2R 20447146..20447297 751..902 100 <- Minus
arm_2R 20447353..20447748 355..750 100 <- Minus
arm_2R 20447815..20447933 236..354 100 <- Minus
arm_2R 20448376..20448610 1..235 100   Minus

FI20112.hyp Sequence

Translation from 0 to 1043

> FI20112.hyp
DRLNSGLKKMLAKITRSSFYASRAVGRLSGSIPTSPAALASNCRYIQIER
KRTKSHEMALYETVEKGAKNSPSYSLYFKNKCGNVISPMHDIPLYANEEK
TIYNMVVEVPRWTNAKMEISLKTPMNPIKQDIKKGKLRFVANCFPHKGYI
WNYGALPQTWENPDHIEPSTGCKGDNDPIDVIEIGYRVAKRGDVLKVKVL
GTIALIDEGETDWKIIAIDVNDPLASKVNDIADVDQYFPGLLRATVEWFK
IYKIPDGKPENQFAFNGDAKNADFANTIIAETHKFWQNLVHQSPASGSIS
TTNITNRNSEHVIPKEEAEKILAEAPDGGQVEEVSDTVDTWHFIHLK*

FI20112.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
Nurf-38-PA 338 CG4634-PA 1..338 10..347 1794 100 Plus
Nurf-38-PB 290 CG4634-PB 1..290 58..347 1557 100 Plus
Nurf-38-PC 290 CG4634-PC 1..280 58..337 1496 100 Plus

FI20112.pep Sequence

Translation from 0 to 1043

> FI20112.pep
DRLNSGLKKMLAKITRSSFYASRAVGRLSGSIPTSPAALASNCRYIQIER
KRTKSHEMALYETVEKGAKNSPSYSLYFKNKCGNVISPMHDIPLYANEEK
TIYNMVVEVPRWTNAKMEISLKTPMNPIKQDIKKGKLRFVANCFPHKGYI
WNYGALPQTWENPDHIEPSTGCKGDNDPIDVIEIGYRVAKRGDVLKVKVL
GTIALIDEGETDWKIIAIDVNDPLASKVNDIADVDQYFPGLLRATVEWFK
IYKIPDGKPENQFAFNGDAKNADFANTIIAETHKFWQNLVHQSPASGSIS
TTNITNRNSEHVIPKEEAEKILAEAPDGGQVEEVSDTVDTWHFIHLK*

FI20112.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11243-PA 333 GF11243-PA 1..333 10..347 1495 86.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19918-PA 290 GG19918-PA 1..290 58..347 1544 98.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21893-PA 291 GH21893-PA 1..291 58..347 1355 84.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
Nurf-38-PA 338 CG4634-PA 1..338 10..347 1794 100 Plus
Nurf-38-PB 290 CG4634-PB 1..290 58..347 1557 100 Plus
Nurf-38-PC 290 CG4634-PC 1..280 58..337 1496 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20392-PA 291 GI20392-PA 1..291 58..347 1351 85.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10109-PA 281 GL10109-PA 1..281 58..347 1343 87.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25082-PA 291 GA25082-PA 1..291 58..347 1440 91.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11820-PA 290 GM11820-PA 1..290 58..347 1559 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24942-PA 290 GD24942-PA 1..290 58..347 1559 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22117-PA 291 GJ22117-PA 1..291 58..347 1377 88 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19471-PA 289 GK19471-PA 1..289 58..347 1421 90 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11442-PA 290 GE11442-PA 1..290 58..347 1532 97.6 Plus