Clone FI20201 Report

Search the DGRC for FI20201

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:202
Well:1
Vector:pFlc-1
Associated Gene/TranscriptCG34424-RA
Protein status:FI20201.pep: gold
Sequenced Size:926

Clone Sequence Records

FI20201.complete Sequence

926 bp assembled on 2012-04-04

GenBank Submission: BT133356.1

> FI20201.complete
AGTGGATAACTCCCATCCCTGATCAGCTGATCGCCCCGCGGCTCACCCAA
ACTGCAAGCCTAAACTTTCCCCAGACCGCTCCACTTCCATTTGTTTACGA
ACAGCGCTGCAAAGCGGAACAGCCGACAGATAAGCGTCAGTGTAAGCGCA
GCTGATAACGGGCGGCGGAGTGGCGACCTAAAGACGCATGGACCGCGCAG
GCAGATGGAAACAGTTCGCACCGGTTCGCTCGAGTGTGCAGTAGATGATC
CAGCGGCAGGAATGGCGGCCACGATCCAGAACACCCTGAAGGTGGCGCTG
CGAAAGCGCATGAAGGATGCACTGAAGGGCATCGACGCGGAGGCCATCGC
CCGGCAGTCGCAGGCCGTCACGGCTAAGGTGCTGCAAAGCGAGATCTTCC
GGCAGGCGCAGCGGGTGAGCATTTACCTGAGCACAGCCTCGGAGCTGGAC
ACCACGGCGCTGCTGTCGGAGATGTTCCGCCTGGAGAAGATGGTCTTTGT
GCCCACCTACGAGGGCAGCAGGATGAAGATGGTGCGGCTGCGCGGCATGG
AGGAGTACGAGAGCCTGCCTCTGACCAAGTGGAACATAAAGCAGCCGGAC
TTCAAGGAGGCACGCGAGGATGCCATGACCAACGGGCACGGCATCGATCT
CTTCATTGTGCCCGGTGTGGCCTTCACCCGCTGCGGAGCTCGGATGGGCC
ATGGCATGGGCTACTACGACAAGTTCCTCAAGCAGCACGCGGAGAAGTAT
CCGCACAAGAAGATCTCGCTGATGGCACTGTCGCTCAACGAGCAGATAGT
CAGCAACGAGGAGTTGCCCATGGAGTCGCACGACGTCCGTTTGCACAGTG
TAATTACGGAAAACTAACTTTTGGCTTACATACAAAGTGGGAAGTAAAGC
GAACTAATACGAAAAAAAAAAAAAAA

FI20201.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19245535..19245912 3..380 1875 99.7 Plus
chr2R 21145070 chr2R 19246303..19246580 634..911 1330 98.6 Plus
chr2R 21145070 chr2R 19245982..19246240 377..635 1220 98.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:14:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23359221..23359598 3..380 1890 100 Plus
2R 25286936 2R 23359989..23360269 634..914 1405 100 Plus
2R 25286936 2R 23359668..23359926 377..635 1295 100 Plus
Blast to na_te.dros performed on 2019-03-15 13:14:18 has no hits.

FI20201.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:15:04 Download gff for FI20201.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19245533..19245910 1..378 99 -> Plus
chr2R 19245984..19246239 379..634 98 -> Plus
chr2R 19246304..19246580 635..911 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2012-04-04 13:43:30 Download gff for FI20201.complete
Subject Subject Range Query Range Percent Splice Strand
CG34424-RA 1..606 262..867 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:59:35 Download gff for FI20201.complete
Subject Subject Range Query Range Percent Splice Strand
CG34424-RB 1..606 262..867 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:25:36 Download gff for FI20201.complete
Subject Subject Range Query Range Percent Splice Strand
CG34424-RB 1..606 262..867 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-04 13:43:30 Download gff for FI20201.complete
Subject Subject Range Query Range Percent Splice Strand
CG34424-RA 1..911 1..911 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:59:35 Download gff for FI20201.complete
Subject Subject Range Query Range Percent Splice Strand
CG34424-RA 5..915 1..911 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:25:36 Download gff for FI20201.complete
Subject Subject Range Query Range Percent Splice Strand
CG34424-RA 5..915 1..911 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:15:04 Download gff for FI20201.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23359990..23360266 635..911 100   Plus
2R 23359219..23359596 1..378 99 -> Plus
2R 23359670..23359925 379..634 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:15:04 Download gff for FI20201.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23359990..23360266 635..911 100   Plus
2R 23359219..23359596 1..378 99 -> Plus
2R 23359670..23359925 379..634 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:15:04 Download gff for FI20201.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23359990..23360266 635..911 100   Plus
2R 23359219..23359596 1..378 99 -> Plus
2R 23359670..23359925 379..634 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:59:35 Download gff for FI20201.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19247513..19247789 635..911 100   Plus
arm_2R 19246742..19247119 1..378 99 -> Plus
arm_2R 19247193..19247448 379..634 100 -> Plus

FI20201.hyp Sequence

Translation from 204 to 866

> FI20201.hyp
METVRTGSLECAVDDPAAGMAATIQNTLKVALRKRMKDALKGIDAEAIAR
QSQAVTAKVLQSEIFRQAQRVSIYLSTASELDTTALLSEMFRLEKMVFVP
TYEGSRMKMVRLRGMEEYESLPLTKWNIKQPDFKEAREDAMTNGHGIDLF
IVPGVAFTRCGARMGHGMGYYDKFLKQHAEKYPHKKISLMALSLNEQIVS
NEELPMESHDVRLHSVITEN*

FI20201.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG34424-PA 201 CG34424-PA 1..201 20..220 1015 100 Plus
CG34424-PB 201 CG34424-PB 1..201 20..220 1015 100 Plus

FI20201.pep Sequence

Translation from 204 to 866

> FI20201.pep
METVRTGSLECAVDDPAAGMAATIQNTLKVALRKRMKDALKGIDAEAIAR
QSQAVTAKVLQSEIFRQAQRVSIYLSTASELDTTALLSEMFRLEKMVFVP
TYEGSRMKMVRLRGMEEYESLPLTKWNIKQPDFKEAREDAMTNGHGIDLF
IVPGVAFTRCGARMGHGMGYYDKFLKQHAEKYPHKKISLMALSLNEQIVS
NEELPMESHDVRLHSVITEN*

FI20201.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13140-PA 201 GF13140-PA 1..200 20..219 852 83 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22846-PA 227 GG22846-PA 8..227 1..220 1130 95.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20670-PA 201 GH20670-PA 2..200 22..220 828 75.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
Mthfs-PA 201 CG34424-PA 1..201 20..220 1015 100 Plus
Mthfs-PB 201 CG34424-PB 1..201 20..220 1015 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19030-PA 201 GI19030-PA 2..200 22..220 889 80.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11441-PA 227 GL11441-PA 76..226 69..219 751 87.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10745-PA 244 GA10745-PA 44..243 20..219 943 86 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16002-PA 318 GM16002-PA 99..318 1..220 1154 96.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11755-PA 223 GD11755-PA 118..222 1..105 507 94.3 Plus
Dsim\GD11756-PA 80 GD11756-PA 1..80 141..220 442 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19998-PA 202 GJ19998-PA 1..201 20..220 879 78.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22918-PA 201 GK22918-PA 1..200 20..219 857 77.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14282-PA 227 GE14282-PA 8..227 1..220 1133 95 Plus