Clone FI20231 Report

Search the DGRC for FI20231

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:202
Well:31
Vector:pFlc-1
Associated Gene/TranscriptFdxh-RA
Protein status:FI20231.pep: gold
Sequenced Size:709

Clone Sequence Records

FI20231.complete Sequence

709 bp assembled on 2012-04-04

GenBank Submission: BT133357.1

> FI20231.complete
GCCTGCAACCTCAAAAAAATGTTTTGTTTACTTTTGCGCCGCTCTGCAGT
TCATAATTCCTGCAAATTAATCAGTAAACAGATTGCCAAGCCCGCGTTCT
ACACACCCCACAATGCTCTGCACACCACAATACCGCGGCGGCATGGCGAG
TTCGAATGGCAGGATCCCAAGTCCACGGATGAAATAGTGAACATCACATA
TGTGGACAAGGATGGAAAGCGCACCAAGGTCCAGGGCAAAGTGGGCGACA
ATGTTCTGTACTTGGCCCATCGCCATGGAATCGAGATGGAAGGCGCCTGT
GAGGCTTCGCTGGCCTGCACCACCTGTCACGTGTACGTCCAGCATGATTA
CCTGCAGAAGTTAAAAGAGGCCGAGGAGCAGGAGGACGACCTGCTGGATA
TGGCGCCATTTCTGCGCGAGAACTCCCGGCTCGGCTGTCAGATACTCCTC
GACAAGAGTATGGAGGGCATGGAACTGGAGCTGCCCAAGGCCACCAGGAA
CTTCTACGTCGATGGGCACAAGCCCAAGCCACATTAACATTATTGTTATA
TCCCGCATTATTAATAATATATAACGACTGTTGAATTACCATTTGGTTCT
TTCCCAACTTTGTATATTTCTTAAGATGTAAACAATGCTTCGGTTTTGTG
TTGTTCCATCGTGAATTAAACTAAAGAAGAATTCGTTAAGTCGAAAAAAA
AAAAAAAAA

FI20231.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9362083..9362588 691..186 2530 100 Minus
chr3L 24539361 chr3L 9362790..9362920 133..3 640 99.2 Minus
chr3L 24539361 chr3L 9362651..9362702 185..134 260 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9370193..9370702 695..186 2535 99.8 Minus
3L 28110227 3L 9370904..9371034 133..3 640 99.2 Minus
3L 28110227 3L 9370765..9370816 185..134 260 100 Minus
Blast to na_te.dros performed on 2019-03-15 13:15:37 has no hits.

FI20231.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:16:30 Download gff for FI20231.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9362081..9362588 186..693 99 <- Minus
chr3L 9362651..9362702 134..185 100 <- Minus
chr3L 9362790..9362923 1..133 98   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2012-04-04 13:43:35 Download gff for FI20231.complete
Subject Subject Range Query Range Percent Splice Strand
Fdxh-RB 1..519 19..537 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:00:06 Download gff for FI20231.complete
Subject Subject Range Query Range Percent Splice Strand
Fdxh-RA 1..519 19..537 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:26:25 Download gff for FI20231.complete
Subject Subject Range Query Range Percent Splice Strand
Fdxh-RA 1..519 19..537 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-04 13:43:34 Download gff for FI20231.complete
Subject Subject Range Query Range Percent Splice Strand
Fdxh-RB 30..723 1..693 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:00:06 Download gff for FI20231.complete
Subject Subject Range Query Range Percent Splice Strand
Fdxh-RA 22..715 1..693 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:26:25 Download gff for FI20231.complete
Subject Subject Range Query Range Percent Splice Strand
Fdxh-RA 22..715 1..693 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:30 Download gff for FI20231.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9370195..9370702 186..693 99 <- Minus
3L 9370765..9370816 134..185 100 <- Minus
3L 9370904..9371037 1..133 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:30 Download gff for FI20231.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9370195..9370702 186..693 99 <- Minus
3L 9370765..9370816 134..185 100 <- Minus
3L 9370904..9371037 1..133 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:16:30 Download gff for FI20231.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9370195..9370702 186..693 99 <- Minus
3L 9370765..9370816 134..185 100 <- Minus
3L 9370904..9371037 1..133 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:00:06 Download gff for FI20231.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9364004..9364137 1..133 98   Minus
arm_3L 9363295..9363802 186..693 99 <- Minus
arm_3L 9363865..9363916 134..185 100 <- Minus

FI20231.hyp Sequence

Translation from 0 to 536

> FI20231.hyp
HCNLKKMFCLLLRRSAVHNSCKLISKQIAKPAFYTPHNALHTTIPRRHGE
FEWQDPKSTDEIVNITYVDKDGKRTKVQGKVGDNVLYLAHRHGIEMEGAC
EASLACTTCHVYVQHDYLQKLKEAEEQEDDLLDMAPFLRENSRLGCQILL
DKSMEGMELELPKATRNFYVDGHKPKPH*

FI20231.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Fdxh-PB 172 CG4205-PB 1..172 7..178 927 100 Plus
Fdxh-PA 172 CG4205-PA 1..172 7..178 927 100 Plus
CG1319-PB 152 CG1319-PB 37..143 59..162 228 42.1 Plus

FI20231.pep Sequence

Translation from 0 to 536

> FI20231.pep
ACNLKKMFCLLLRRSAVHNSCKLISKQIAKPAFYTPHNALHTTIPRRHGE
FEWQDPKSTDEIVNITYVDKDGKRTKVQGKVGDNVLYLAHRHGIEMEGAC
EASLACTTCHVYVQHDYLQKLKEAEEQEDDLLDMAPFLRENSRLGCQILL
DKSMEGMELELPKATRNFYVDGHKPKPH*

FI20231.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23741-PA 172 GF23741-PA 1..172 7..178 852 90.7 Plus
Dana\GF25062-PA 152 GF25062-PA 3..148 17..167 229 33.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14049-PA 172 GG14049-PA 1..172 7..178 912 98.3 Plus
Dere\GG15219-PA 152 GG15219-PA 3..144 17..163 236 36 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 00:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16986-PA 170 GH16986-PA 1..170 7..178 741 81.4 Plus
Dgri\GH16023-PA 163 GH16023-PA 50..156 61..164 212 37.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
Fdx1-PB 172 CG4205-PB 1..172 7..178 927 100 Plus
Fdx1-PA 172 CG4205-PA 1..172 7..178 927 100 Plus
Fdx2-PB 152 CG1319-PB 37..143 59..162 228 42.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 00:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11398-PA 170 GI11398-PA 1..170 7..178 743 81.4 Plus
Dmoj\GI12288-PA 161 GI12288-PA 48..152 61..162 225 40 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 00:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22634-PA 170 GL22634-PA 1..170 7..178 709 83.7 Plus
Dper\GL16335-PA 158 GL16335-PA 3..150 17..163 235 32.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 00:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24929-PA 170 GA24929-PA 1..170 7..178 715 84.3 Plus
Dpse\GA12105-PA 158 GA12105-PA 3..151 17..164 233 32.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24883-PA 172 GM24883-PA 1..172 7..178 924 98.8 Plus
Dsec\GM14650-PA 152 GM14650-PA 3..144 17..163 234 35.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12935-PA 172 GD12935-PA 1..172 7..178 924 98.8 Plus
Dsim\GD13836-PA 152 GD13836-PA 3..144 17..163 234 35.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 00:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13593-PA 170 GJ13593-PA 1..170 7..178 742 81.4 Plus
Dvir\GJ13225-PA 160 GJ13225-PA 2..151 23..162 229 35.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 00:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16567-PA 173 GK16567-PA 1..173 7..178 718 78.3 Plus
Dwil\GK11844-PA 159 GK11844-PA 46..150 61..162 218 39 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21252-PA 172 GE21252-PA 1..172 7..178 920 98.8 Plus
Dyak\GE21438-PA 116 GE21438-PA 5..112 63..167 221 40.7 Plus