Clone FI21759 Report

Search the DGRC for FI21759

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:217
Well:59
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG13526-RA
Protein status:FI21759.pep: gold
Sequenced Size:639

Clone Sequence Records

FI21759.complete Sequence

639 bp assembled on 2013-06-26

GenBank Submission: BT150143.1

> FI21759.complete
ATTTCTGCTTTTTTTTGTATTCTTGATTTTCCTGAACTACTTTAGGGTTT
TATTTGCTAGTGCCATGCCTTCTTTTTCCGGCAATGAGCTGACGAATGAG
CATATCGACGAACTGAGGGATGCCTTTGAAAAGTATGATCTGGACTCGAA
TGGCACTCTATCAGCCAACGAGGTGCGACTGGCTCTAATATCAGTGGGTT
ACGAAATCACTGAGGCAGAGTTGTACGATCTCATCCATTCGGTGGCTGTG
AGAGACGAGGAGAGGCTGGACTTGAAAAAATTTATACGCATGATGGCGCC
CCGAATGGCCAATGTGGATAGTGATAAAAGTCTATGCCGGACCTTTAACA
TGATTGACCGCGATCGCGACGGCTACGTCACCGTCCAGGATGTTCGTGCC
ATTATGGTCGTCCTGGGCGAAGTCGTAACCGATGACGATATTAAGGATAT
CTGCCAAGCAGTCGATATGGATGGCGATGGTCGCATAAGCTTGCGCGATT
TCGTAGGCTTTATGCACAGCCCCATTTGAGCTGAGACTGCAAGCAAAATT
AAACATTAAGCACAATGAAAAATGTATCTCACAAATCTATTGTAGACTAT
AATAAAAATTATTGTTTTCATAAAAAAAAAAAAAAAAAA

FI21759.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18641727..18642349 1..621 2945 98.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22755269..22755898 9..623 2735 96.3 Plus
Blast to na_te.dros performed on 2019-03-15 14:32:50 has no hits.

FI21759.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:34:09 Download gff for FI21759.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18641748..18642319 22..591 98 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2013-06-26 12:40:21 Download gff for FI21759.complete
Subject Subject Range Query Range Percent Splice Strand
CG13526-RA 1..465 65..529 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:33:48 Download gff for FI21759.complete
Subject Subject Range Query Range Percent Splice Strand
CG13526-RA 1..465 65..529 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:02:03 Download gff for FI21759.complete
Subject Subject Range Query Range Percent Splice Strand
CG13526-RA 1..465 65..529 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-06-26 12:40:21 Download gff for FI21759.complete
Subject Subject Range Query Range Percent Splice Strand
CG13526-RA 43..577 22..556 99 -> Plus
CG13526-RA 591..657 557..621 92   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:33:48 Download gff for FI21759.complete
Subject Subject Range Query Range Percent Splice Strand
CG13526-RA 64..598 22..556 99 -> Plus
CG13526-RA 612..678 557..621 92   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:02:03 Download gff for FI21759.complete
Subject Subject Range Query Range Percent Splice Strand
CG13526-RA 64..598 22..556 99 -> Plus
CG13526-RA 612..678 557..621 92   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:34:09 Download gff for FI21759.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22755282..22755816 22..556 99 -> Plus
2R 22755830..22755896 557..621 92   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:34:09 Download gff for FI21759.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22755282..22755816 22..556 99 -> Plus
2R 22755830..22755896 557..621 92   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:34:09 Download gff for FI21759.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22755282..22755816 22..556 99 -> Plus
2R 22755830..22755896 557..621 92   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:33:48 Download gff for FI21759.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18642787..18643321 22..556 99 -> Plus
arm_2R 18643335..18643401 557..621 92   Plus

FI21759.pep Sequence

Translation from 1 to 528

> FI21759.pep
FLLFFVFLIFLNYFRVLFASAMPSFSGNELTNEHIDELRDAFEKYDLDSN
GTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKKFIRMMAP
RMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDI
CQAVDMDGDGRISLRDFVGFMHSPI*

FI21759.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13535-PA 151 GF13535-PA 4..151 28..175 437 54.7 Plus
Dana\GF12835-PA 149 GF12835-PA 3..148 28..173 267 34.2 Plus
Dana\GF16772-PA 148 GF16772-PA 2..142 28..168 247 34 Plus
Dana\GF13649-PA 155 GF13649-PA 6..151 23..168 186 28.1 Plus
Dana\GF13648-PA 151 GF13648-PA 14..145 36..167 185 30.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22789-PA 154 GG22789-PA 1..154 22..175 676 83.1 Plus
Dere\GG20265-PA 149 GG20265-PA 3..148 28..173 267 34.2 Plus
Dere\GG11425-PA 148 GG11425-PA 2..142 28..168 253 36.2 Plus
Dere\GG23318-PA 147 GG23318-PA 4..147 30..173 231 33.3 Plus
Dere\GG21382-PA 182 GG21382-PA 31..178 23..173 179 23.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21304-PA 151 GH21304-PA 8..146 30..168 251 36 Plus
Dgri\GH23405-PA 151 GH23405-PA 7..145 30..168 227 32.4 Plus
Dgri\GH10976-PA 190 GH10976-PA 39..186 23..173 181 23.2 Plus
Dgri\GH22800-PA 122 GH22800-PA 5..104 27..126 174 34 Plus
Dgri\GH23794-PA 186 GH23794-PA 23..182 11..173 169 22.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13526-PA 154 CG13526-PA 1..154 22..175 785 100 Plus
Cam-PD 149 CG8472-PD 3..148 28..173 278 34.2 Plus
Cam-PC 149 CG8472-PC 3..148 28..173 278 34.2 Plus
Cam-PE 149 CG8472-PE 3..148 28..173 278 34.2 Plus
Cam-PB 149 CG8472-PB 3..148 28..173 278 34.2 Plus
Cam-PA 149 CG8472-PA 3..148 28..173 278 34.2 Plus
Acam-PB 148 CG17769-PB 2..142 28..168 261 35.5 Plus
Acam-PA 148 CG17769-PA 2..142 28..168 261 35.5 Plus
CG30378-PA 148 CG30378-PA 5..148 30..173 229 31.9 Plus
CG11638-PA 387 CG11638-PA 213..358 37..174 196 28.1 Plus
CG17493-PD 182 CG17493-PD 34..176 29..171 193 23.1 Plus
CG17493-PC 182 CG17493-PC 34..176 29..171 193 23.1 Plus
CG17493-PB 182 CG17493-PB 34..176 29..171 193 23.1 Plus
CG31960-PA 148 CG31960-PA 2..145 28..171 192 23.6 Plus
CG13898-PA 151 CG13898-PA 8..145 30..167 191 29 Plus
CG31802-PA 186 CG31802-PA 29..180 20..171 182 22.4 Plus
azot-PA 148 CG11165-PA 3..145 29..171 177 21.7 Plus
TpnC41C-PB 154 CG2981-PB 3..149 28..171 177 26.5 Plus
TpnC41C-PA 154 CG2981-PA 3..149 28..171 177 26.5 Plus
CG17770-PA 164 CG17770-PA 18..161 28..171 172 25.7 Plus
TpnC25D-PC 149 CG6514-PC 4..146 32..171 159 25.2 Plus
TpnC25D-PA 149 CG6514-PA 4..146 32..171 159 25.2 Plus
Eip63F-1-PC 181 CG15855-PC 11..176 21..167 158 23.5 Plus
Eip63F-1-PA 193 CG15855-PA 23..188 21..167 158 23.5 Plus
TpnC25D-PB 143 CG6514-PB 1..140 35..171 154 25 Plus
Eip63F-1-PD 166 CG15855-PD 10..161 35..167 151 23 Plus
TpnC4-PB 153 CG12408-PB 5..151 29..171 150 27 Plus
TpnC4-PA 153 CG12408-PA 5..151 29..171 150 27 Plus
Eip63F-1-PB 161 CG15855-PB 8..156 38..167 148 23.5 Plus
TpnC47D-PB 155 CG9073-PB 7..152 29..171 145 24.7 Plus
TpnC47D-PA 155 CG9073-PA 7..152 29..171 145 24.7 Plus
TpnC73F-PC 155 CG7930-PC 7..152 29..171 141 24 Plus
TpnC73F-PA 155 CG7930-PA 7..152 29..171 141 24 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20594-PA 149 GI20594-PA 3..148 28..173 267 34.2 Plus
Dmoj\GI19794-PA 151 GI19794-PA 4..146 23..168 245 34.2 Plus
Dmoj\GI10339-PA 149 GI10339-PA 4..143 29..168 234 34.3 Plus
Dmoj\GI10340-PA 150 GI10340-PA 5..149 29..174 223 32.2 Plus
Dmoj\GI19793-PA 149 GI19793-PA 3..147 29..173 182 24.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11703-PA 149 GL11703-PA 2..149 26..173 270 35.1 Plus
Dper\GL10814-PA 149 GL10814-PA 3..148 28..173 267 34.2 Plus
Dper\GL21535-PA 148 GL21535-PA 3..148 29..174 263 34.2 Plus
Dper\GL21536-PA 148 GL21536-PA 3..147 29..173 254 34.5 Plus
Dper\GL11704-PA 151 GL11704-PA 8..146 30..168 245 33.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24239-PA 149 GA24239-PA 2..149 26..173 279 36.5 Plus
Dpse\GA24499-PA 149 GA24499-PA 3..148 28..173 267 34.2 Plus
Dpse\GA14657-PA 148 GA14657-PA 3..148 29..174 263 34.2 Plus
Dpse\GA26322-PA 148 GA26322-PA 3..147 29..173 254 34.5 Plus
Dpse\GA24240-PA 151 GA24240-PA 8..146 30..168 248 33.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15947-PA 154 GM15947-PA 1..154 22..175 761 94.8 Plus
Dsec\GM21351-PA 149 GM21351-PA 3..148 28..173 267 34.2 Plus
Dsec\GM10265-PA 148 GM10265-PA 2..142 28..168 256 35.5 Plus
Dsec\GM20995-PA 148 GM20995-PA 5..148 30..173 230 33.3 Plus
Dsec\GM14251-PA 151 GM14251-PA 8..146 30..168 182 29.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11700-PA 163 GD11700-PA 1..163 22..175 733 88.3 Plus
Dsim\GD10849-PA 149 GD10849-PA 3..148 28..173 267 34.2 Plus
Dsim\GD21235-PA 148 GD21235-PA 2..142 28..168 256 35.5 Plus
Dsim\GD10525-PA 148 GD10525-PA 5..148 30..173 229 33.3 Plus
Dsim\GD13508-PA 151 GD13508-PA 8..146 30..168 175 28.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22045-PA 158 GJ22045-PA 1..148 22..173 288 38.8 Plus
Dvir\GJ15117-PA 152 GJ15117-PA 1..147 22..168 268 36.1 Plus
Dvir\GJ10193-PA 151 GJ10193-PA 6..145 29..168 239 35 Plus
Dvir\GJ20779-PA 113 GJ20779-PA 3..112 64..173 205 34.5 Plus
Dvir\GJ19846-PA 184 GJ19846-PA 32..180 22..173 190 25 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21452-PA 158 GK21452-PA 6..150 29..173 306 42.8 Plus
Dwil\GK22183-PA 149 GK22183-PA 3..148 28..173 267 34.2 Plus
Dwil\GK18988-PA 148 GK18988-PA 2..142 28..168 264 36.9 Plus
Dwil\GK21975-PA 147 GK21975-PA 3..142 29..168 257 38.6 Plus
Dwil\GK19415-PA 112 GK19415-PA 3..112 64..173 203 38.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14019-PA 154 GE14019-PA 1..154 22..175 719 87.7 Plus
Dyak\Cam-PA 149 GE12425-PA 3..148 28..173 267 34.2 Plus
Dyak\GE23620-PA 148 GE23620-PA 2..142 28..168 255 36.2 Plus
Dyak\GE19162-PA 147 GE19162-PA 4..147 30..173 224 33.3 Plus
Dyak\GE18259-PA 148 GE18259-PA 3..147 29..173 190 26.9 Plus

FI21759.hyp Sequence

Translation from 22 to 528

> FI21759.hyp
LIFLNYFRVLFASAMPSFSGNELTNEHIDELRDAFEKYDLDSNGTLSANE
VRLALISVGYEITEAELYDLIHSVAVRDEERLDLKKFIRMMAPRMANVDS
DKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMD
GDGRISLRDFVGFMHSPI*

FI21759.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13526-PA 154 CG13526-PA 1..154 15..168 785 100 Plus
Cam-PD 149 CG8472-PD 3..148 21..166 278 34.2 Plus
Cam-PC 149 CG8472-PC 3..148 21..166 278 34.2 Plus
Cam-PE 149 CG8472-PE 3..148 21..166 278 34.2 Plus
Cam-PB 149 CG8472-PB 3..148 21..166 278 34.2 Plus