Clone FI21921 Report

Search the DGRC for FI21921

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:219
Well:21
Vector:pOTB7
Associated Gene/Transcriptscpr-A-RA
Protein status:FI21921.pep: gold
Sequenced Size:892

Clone Sequence Records

FI21921.complete Sequence

892 bp assembled on 2013-07-17

GenBank Submission: BT150158.1

> FI21921.complete
AAGAACTAGCATCATGGCGTTCACCAAGGTTCTCCAATTGATTCTCCTAG
CTGTGGTTGCCATTTCCTCTGCCGTCGACTATTGTGCTCTCCCCACCTGT
CTGGACAAGCATGTGGCCTGTAACAACAAGGGAAACTTCAGTGAAAATTG
TCCCAAAGACGTGCGTGAGGTGAAGATCGAGCCGCATCACAAACTCATCC
TCAATCTCTTCAACGAGTTGCGCAACAACGTGGCTGGAGGCAAAATAGAA
GGACTACCCAAGGCTGTTCGCATGGCCAAGATGTCCTGGTGCGAGGAGCT
CTCCCATCTGGCCTTGCTGAACGTAAAGACCTGTGAGTCCCTGCCAGATA
AATGTCGCAGCACCGAGAGATTCGCCTACGCCGGCCAGAACAACGCCTTG
TTCCAGTACAGCGGAGCCGAGACAGAGTACACCGATGCGGAAATAATAAA
GGAGGAGATCGAGAACTGGTTTGCTGAGCGCTCGAATGCATCTCCCGAGA
TCCTCGCCAGCTTCCCGGAGGAGCTTCCCAACAAAGCGGTGACCAAGTTC
ACCATCGCGGTGGCCGAGAAGAACACCCATGTGGGATGTGCCGCGGTGCG
CTTCTCCCGGGACTTTTACAACCACTTCGTACTCACCTGCAACTTCGCCA
CATCGAACATTGTGGGTCAGCCTGTCTACACTCCGGGAGAGAAGGCAACC
ACCGGCTGCAAGAACCGATATGGAGCTGCCTACGATTACCCCAATCTGTG
CTACGCCAAGGAGATCTACGACAACGAGAAGGTCATCGAGAACACACAGA
CGATGTAAATGCTTTTTCGATTCTTAGTCCATAATTAAGTTGGCAAATAA
AAGCTAAAAGAGCTTATCATTTGAAAAAAAAAAAAAAAAAAA

FI21921.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7066955..7067694 134..873 3580 98.9 Plus
chr3R 27901430 chr3R 7065713..7066383 807..137 3250 99 Minus
chr3R 27901430 chr3R 7051298..7051968 137..807 3190 98.4 Plus
chr3R 27901430 chr3R 7066757..7066889 1..133 665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11241381..11242123 134..876 3595 98.9 Plus
3R 32079331 3R 11240139..11240809 807..137 3250 99 Minus
3R 32079331 3R 11225706..11226376 137..807 3205 98.5 Plus
3R 32079331 3R 11241183..11241315 1..133 665 100 Plus
Blast to na_te.dros performed 2019-03-15 11:18:05
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker4 7359 Stalker4 STALKER4 7359bp 1566..1631 771..837 134 72.5 Plus
Stalker 7256 Stalker STALKER 7256bp 1459..1524 771..837 134 72.5 Plus

FI21921.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:19:01 Download gff for FI21921.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7066757..7066889 1..133 100 -> Plus
chr3R 7066955..7067694 134..873 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2013-07-17 16:29:10 Download gff for FI21921.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-A-RA 1..795 14..808 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:26:36 Download gff for FI21921.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-A-RA 1..795 14..808 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:29:28 Download gff for FI21921.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-A-RA 1..795 14..808 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-07-17 16:29:10 Download gff for FI21921.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-A-RA 1..873 1..873 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:26:36 Download gff for FI21921.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-A-RA 1..873 1..873 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:29:28 Download gff for FI21921.complete
Subject Subject Range Query Range Percent Splice Strand
scpr-A-RA 1..873 1..873 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:19:01 Download gff for FI21921.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11241183..11241315 1..133 100 -> Plus
3R 11241381..11242120 134..873 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:19:01 Download gff for FI21921.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11241183..11241315 1..133 100 -> Plus
3R 11241381..11242120 134..873 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:19:01 Download gff for FI21921.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11241183..11241315 1..133 100 -> Plus
3R 11241381..11242120 134..873 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:36 Download gff for FI21921.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7066905..7067037 1..133 100 -> Plus
arm_3R 7067103..7067842 134..873 98   Plus

FI21921.hyp Sequence

Translation from 0 to 807

> FI21921.hyp
RTSIMAFTKVLQLILLAVVAISSAVDYCALPTCLDKHVACNNKGNFSENC
PKDVREVKIEPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEEL
SHLALLNVKTCESLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEIIK
EEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVR
FSRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLC
YAKEIYDNEKVIENTQTM*

FI21921.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
scpr-A-PA 264 CG5207-PA 1..264 5..268 1398 100 Plus
scpr-B-PA 262 CG17210-PA 7..262 13..268 1324 95.7 Plus
scpr-C-PB 262 CG5106-PB 7..262 13..268 1321 95.3 Plus
scpr-C-PA 262 CG5106-PA 7..262 13..268 1321 95.3 Plus
Ag5r2-PA 254 CG9540-PA 5..250 11..257 414 34.8 Plus

FI21921.pep Sequence

Translation from 1 to 807

> FI21921.pep
RTSIMAFTKVLQLILLAVVAISSAVDYCALPTCLDKHVACNNKGNFSENC
PKDVREVKIEPHHKLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEEL
SHLALLNVKTCESLPDKCRSTERFAYAGQNNALFQYSGAETEYTDAEIIK
EEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVR
FSRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLC
YAKEIYDNEKVIENTQTM*

FI21921.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18165-PA 262 GF18165-PA 5..256 12..262 1216 87.7 Plus
Dana\GF16741-PA 260 GF16741-PA 5..258 13..266 1210 83.5 Plus
Dana\GF18253-PA 268 GF18253-PA 11..267 14..267 1200 83.7 Plus
Dana\GF21598-PA 255 GF21598-PA 5..251 10..257 436 33.5 Plus
Dana\GF21595-PA 256 GF21595-PA 8..255 10..257 420 37.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18056-PA 264 GG18056-PA 1..264 5..268 1335 92.4 Plus
Dere\GG17989-PA 262 GG17989-PA 18..262 24..268 1267 93.9 Plus
Dere\GG17230-PA 262 GG17230-PA 18..262 24..268 1266 93.9 Plus
Dere\GG19450-PA 288 GG19450-PA 38..284 10..257 429 34.3 Plus
Dere\GG13982-PA 277 GG13982-PA 9..262 5..258 382 35.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14934-PA 265 GH14934-PA 2..263 7..266 1187 80.9 Plus
Dgri\GH17351-PA 260 GH17351-PA 5..258 13..266 1186 82.7 Plus
Dgri\GH18802-PA 260 GH18802-PA 2..254 9..262 1167 81.9 Plus
Dgri\GH17451-PA 253 GH17451-PA 3..252 10..257 425 36 Plus
Dgri\GH24697-PA 274 GH24697-PA 16..268 5..257 401 33.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
scpr-A-PA 264 CG5207-PA 1..264 5..268 1398 100 Plus
scpr-B-PA 262 CG17210-PA 7..262 13..268 1324 95.7 Plus
scpr-C-PB 262 CG5106-PB 7..262 13..268 1321 95.3 Plus
scpr-C-PA 262 CG5106-PA 7..262 13..268 1321 95.3 Plus
Ag5r2-PA 254 CG9540-PA 5..250 11..257 414 34.8 Plus
CG6628-PA 277 CG6628-PA 24..262 20..258 394 38.5 Plus
CG32679-PA 254 CG32679-PA 10..248 11..257 370 34.9 Plus
Ag5r-PC 256 CG9538-PC 5..250 10..257 366 33.1 Plus
Ag5r-PB 256 CG9538-PB 5..250 10..257 366 33.1 Plus
Ag5r-PA 256 CG9538-PA 5..250 10..257 366 33.1 Plus
CG9822-PA 263 CG9822-PA 6..257 7..257 366 34 Plus
CG31296-PB 280 CG31296-PB 20..261 22..266 357 33.7 Plus
CG31296-PA 280 CG31296-PA 20..261 22..266 357 33.7 Plus
CG17575-PA 291 CG17575-PA 9..287 11..261 351 33.1 Plus
CG17575-PB 298 CG17575-PB 9..294 11..261 336 32.8 Plus
CG3640-PA 296 CG3640-PA 9..251 14..257 332 34.1 Plus
CG42564-PA 500 CG10284-PA 54..284 26..257 329 35.3 Plus
CG9400-PA 308 CG9400-PA 45..302 22..268 318 30.5 Plus
CG42780-PA 253 CG42780-PA 8..250 13..250 311 30.9 Plus
CG17974-PA 259 CG17974-PA 10..256 10..257 310 31.9 Plus
CG42780-PB 254 CG42780-PB 8..251 13..250 302 30.8 Plus
CG34002-PB 350 CG34002-PB 9..251 8..250 263 30 Plus
CG10651-PB 316 CG10651-PB 23..252 27..255 229 28.4 Plus
CG10651-PA 316 CG10651-PA 23..252 27..255 229 28.4 Plus
CG30486-PA 263 CG30486-PA 7..250 10..254 223 27.5 Plus
CG8072-PA 247 CG8072-PA 6..247 11..257 207 28.1 Plus
CG43775-PA 272 CG43775-PA 70..262 67..250 184 31 Plus
CG43776-PA 270 CG43776-PA 67..260 66..251 156 27.8 Plus
CG43776-PB 270 CG43776-PB 67..260 66..251 156 27.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:24:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes33-PA 265 GI23699-PA 2..265 7..268 1202 80.3 Plus
Dmoj\GI23890-PA 260 GI23890-PA 5..260 13..268 1193 80.9 Plus
Dmoj\Tes104-PA 260 GI22692-PA 2..258 9..266 1188 81 Plus
Dmoj\GI15744-PA 256 GI15744-PA 5..255 10..257 422 36.6 Plus
Dmoj\GI15745-PA 257 GI15745-PA 6..250 11..257 421 37.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:24:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12032-PA 261 GL12032-PA 18..255 25..262 1179 88.7 Plus
Dper\GL12570-PA 261 GL12570-PA 18..255 25..262 1171 88.2 Plus
Dper\GL20410-PA 254 GL20410-PA 18..250 24..257 400 34.2 Plus
Dper\GL12692-PA 287 GL12692-PA 9..260 11..268 394 32.9 Plus
Dper\GL12693-PA 296 GL12693-PA 10..258 13..264 392 33.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18663-PA 261 GA18663-PA 18..255 25..262 1171 88.2 Plus
Dpse\GA29233-PA 258 GA29233-PA 3..257 1..257 456 37.9 Plus
Dpse\GA21866-PA 254 GA21866-PA 18..250 24..257 400 34.2 Plus
Dpse\GA16157-PA 287 GA16157-PA 9..260 11..268 394 32.9 Plus
Dpse\GA19736-PA 286 GA19736-PA 38..280 25..265 391 38.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26110-PA 262 GM26110-PA 18..262 24..268 1307 98 Plus
Dsec\GM23927-PA 262 GM23927-PA 18..262 24..268 1297 97.1 Plus
Dsec\GM16873-PA 224 GM16873-PA 1..224 45..268 1184 97.8 Plus
Dsec\GM23934-PA 221 GM23934-PA 8..221 55..268 1128 97.2 Plus
Dsec\GM26114-PA 449 GM26114-PA 1..192 5..196 1015 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18744-PA 277 GD18744-PA 1..258 5..262 1341 95.3 Plus
Dsim\GD20669-PA 262 GD20669-PA 18..262 24..268 1301 97.1 Plus
Dsim\GD18740-PA 261 GD18740-PA 18..261 24..268 1225 93.5 Plus
Dsim\GD12870-PA 277 GD12870-PA 7..262 2..258 381 36.6 Plus
Dsim\GD16039-PA 254 GD16039-PA 9..248 10..257 379 34.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24678-PA 261 GJ24678-PA 6..261 13..268 1201 82.8 Plus
Dvir\GJ23982-PA 265 GJ23982-PA 2..265 7..268 1191 79.9 Plus
Dvir\GJ23256-PA 260 GJ23256-PA 12..260 20..268 1177 83.1 Plus
Dvir\GJ23420-PA 260 GJ23420-PA 18..260 26..268 1157 84.8 Plus
Dvir\GJ18605-PA 253 GJ18605-PA 3..252 9..257 443 36.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13988-PA 262 GK13988-PA 8..262 14..268 1175 80.8 Plus
Dwil\GK13291-PA 266 GK13291-PA 7..266 9..268 1163 80.4 Plus
Dwil\GK14308-PA 260 GK14308-PA 3..259 11..267 1159 79.4 Plus
Dwil\GK18435-PA 257 GK18435-PA 23..256 24..257 475 42 Plus
Dwil\GK14730-PA 256 GK14730-PA 17..255 21..257 448 40.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26087-PA 264 GE26087-PA 1..264 5..268 1369 95.5 Plus
Dyak\GE24631-PA 262 GE24631-PA 18..262 24..268 1276 94.7 Plus
Dyak\GE26080-PA 262 GE26080-PA 18..262 24..268 1272 93.5 Plus
Dyak\GE16103-PA 283 GE16103-PA 30..279 11..257 435 35 Plus
Dyak\GE15398-PA 253 GE15398-PA 11..247 13..257 389 36 Plus