Clone FI21959 Report

Search the DGRC for FI21959

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:219
Well:59
Vector:pOTB7
Associated Gene/TranscriptCG30161-RA
Protein status:FI21959.pep: gold
Sequenced Size:852

Clone Sequence Records

FI21959.complete Sequence

852 bp assembled on 2013-07-17

GenBank Submission: BT150169.1

> FI21959.complete
CGATAACAGGCTCACAATTTAAATTAAAATGATTTCTTTAATCTTATACA
TCTGTCTATTTTATAGTGCTGCAGCTGATCGCAATTTAAAAGTAGTTAAG
TATGAGAATTCGGTTGACACCATTGTTAAGAACCTCATCGACAACTGGCA
GTCGCCGCTAGTTTACCTGAAAAGCCGCGGCTACCTGCCGAAGGATGCGC
CCGAAATGGATTTCCAGCAGCTGCAAGGGAACTTGGACCCCAAATTGTCG
TTAAACGACTTAGTTGAGCTGAACAAGGATTCCAAGCGGGAGGCGGAAAC
CAAAAGCCAAGACAATTCCATTGGGCAGATTGATCCGCGGGCAGTCCGAT
CGCTACAAGATCCCAAGGACCTCGAGCTGAAGAAGATGTTCCAAACGCTG
TTCTCTTCGAACGACAAGACTGCCTCCGAGGAGATCAAATCCAAGCTGGG
AGTGTCCTGGGATATGAATGCTTTAAAGACATCCGCCCGTTTGGGTGCCA
AGAAATATCTCGAGAAGTTCAACAACAAGCGAAATAAGGGGATGTCTCTC
TTGCCAATTGAATCCTCAGATGGGACACTTACTAACGAGGCATCTCTAAA
TTTTTCCTCACTTATACCGCATGCCTTGGAAAAGAAAAGCAACGATTCTG
TGAGAAAAACCACTATCAGTAAGCCAAGCTTTCTGAAGGGTGTGGCCAAG
ATTCTGAGCAATCCAGAAATTAGGTATAGAGACTGGGATTCCAAGCCTGC
ACAAGAAATCCTTCCGAAGGCCGCGGGCGCATAGTTTTCAAATTCATTGT
TGATGATTAAATGTTCTTTTAGTAGCAAAAAAAAAAAAAAAAAAAAAAAA
AA

FI21959.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20549424..20550249 826..1 4130 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24663528..24664357 830..1 4150 100 Minus
Blast to na_te.dros performed on 2019-03-15 11:18:30 has no hits.

FI21959.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:19:15 Download gff for FI21959.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20549424..20550249 1..826 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2013-07-17 16:43:09 Download gff for FI21959.complete
Subject Subject Range Query Range Percent Splice Strand
CG30161-RA 1..756 29..784 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:26:54 Download gff for FI21959.complete
Subject Subject Range Query Range Percent Splice Strand
CG30161-RA 1..756 29..784 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:29:52 Download gff for FI21959.complete
Subject Subject Range Query Range Percent Splice Strand
CG30161-RA 1..756 29..784 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-07-17 16:43:09 Download gff for FI21959.complete
Subject Subject Range Query Range Percent Splice Strand
CG30161-RA 1..826 1..826 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:26:54 Download gff for FI21959.complete
Subject Subject Range Query Range Percent Splice Strand
CG30161-RA 21..846 1..826 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:29:52 Download gff for FI21959.complete
Subject Subject Range Query Range Percent Splice Strand
CG30161-RA 21..846 1..826 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:19:15 Download gff for FI21959.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24663532..24664357 1..826 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:19:15 Download gff for FI21959.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24663532..24664357 1..826 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:19:15 Download gff for FI21959.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24663532..24664357 1..826 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:54 Download gff for FI21959.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20551055..20551880 1..826 100   Minus

FI21959.pep Sequence

Translation from 28 to 783

> FI21959.pep
MISLILYICLFYSAAADRNLKVVKYENSVDTIVKNLIDNWQSPLVYLKSR
GYLPKDAPEMDFQQLQGNLDPKLSLNDLVELNKDSKREAETKSQDNSIGQ
IDPRAVRSLQDPKDLELKKMFQTLFSSNDKTASEEIKSKLGVSWDMNALK
TSARLGAKKYLEKFNNKRNKGMSLLPIESSDGTLTNEASLNFSSLIPHAL
EKKSNDSVRKTTISKPSFLKGVAKILSNPEIRYRDWDSKPAQEILPKAAG
A*

FI21959.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11915-PA 243 GF11915-PA 1..242 1..247 590 52.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19904-PA 251 GG19904-PA 1..250 1..250 1074 82 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21569-PA 243 GH21569-PA 31..219 19..227 282 36.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG30161-PA 251 CG30161-PA 1..251 1..251 1269 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19541-PA 263 GI19541-PA 37..237 19..227 274 35.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24749-PA 170 GL24749-PA 2..141 95..231 197 42.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23624-PA 171 GA23624-PA 2..142 95..231 190 39.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11806-PA 192 GM11806-PA 1..192 60..251 898 89.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24930-PA 251 GD24930-PA 1..251 1..251 1201 92 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:25:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21112-PA 236 GJ21112-PA 32..212 19..227 271 36.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:25:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19408-PA 349 GK19408-PA 200..329 104..231 262 47.4 Plus
Dwil\GK19408-PA 349 GK19408-PA 1..181 2..162 204 36.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11429-PA 247 GE11429-PA 1..247 1..251 1093 82.5 Plus

FI21959.hyp Sequence

Translation from 28 to 783

> FI21959.hyp
MISLILYICLFYSAAADRNLKVVKYENSVDTIVKNLIDNWQSPLVYLKSR
GYLPKDAPEMDFQQLQGNLDPKLSLNDLVELNKDSKREAETKSQDNSIGQ
IDPRAVRSLQDPKDLELKKMFQTLFSSNDKTASEEIKSKLGVSWDMNALK
TSARLGAKKYLEKFNNKRNKGMSLLPIESSDGTLTNEASLNFSSLIPHAL
EKKSNDSVRKTTISKPSFLKGVAKILSNPEIRYRDWDSKPAQEILPKAAG
A*

FI21959.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG30161-PA 251 CG30161-PA 1..251 1..251 1269 100 Plus