Clone FI23143 Report

Search the DGRC for FI23143

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:231
Well:43
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptBG642312-RA
Protein status:FI23143.pep: gold
Sequenced Size:578

Clone Sequence Records

FI23143.complete Sequence

578 bp assembled on 2013-09-12

GenBank Submission: BT150233.1

> FI23143.complete
CCCTCTCTACGAACTCAGGACGCTCTTCTTTGGCCACCAGAAAGAGTGAG
TGAAGACTTGGCTAATCGCCGACGACATACGTTGAAGAGCTCCAGACTGG
CACACTTGCACATATAAAAAGTGGACCCAACCGAATTTTGCTTGTCAGTT
AATGCCCATCAATCGAATCAATCCCAGCACAGCCATGAGAAGCGCGTCGC
TTAAGTTCTATCTGATATGTCTGCTAGTTATCTGCGTGATCGGTTGGAGT
GCTGGAGCACCGAGTCCGCAACTTTCACGTAAGGAACTCGAGGATCGATA
TCGACAAAAGCCCCCGGTGCCTGATGAGCGAGATGCGGATGCAGAATTGG
ATAGTGCCTACGATCGGAATACCCGAAGACCTTGAAGTGCAAATCTGAAA
GGCTGGAGACACCCAACGCCCACAATTGATTTGTGGTTCTGTGTGGAGTG
CCACTTTTTATGTCGTATTCAGGGTTATGGCTATGTAGTTCTAAGCTTAG
GCAAAATGTACAAGCGTAAAATAAAGCAATTACTTGGGTGAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI23143.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6224975..6225279 540..236 1525 100 Minus
chr3L 24539361 chr3L 6225343..6225496 236..83 770 100 Minus
chr3L 24539361 chr3L 6225806..6225885 82..3 400 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6232466..6232773 543..236 1540 100 Minus
3L 28110227 3L 6232837..6232990 236..83 770 100 Minus
3L 28110227 3L 6233300..6233381 82..1 410 100 Minus
Blast to na_te.dros performed on 2019-03-17 00:18:34 has no hits.

FI23143.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:19:11 Download gff for FI23143.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6224975..6225278 237..540 100 <- Minus
chr3L 6225343..6225496 83..236 100 <- Minus
chr3L 6225806..6225887 1..82 98   Minus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-09-12 14:18:01 Download gff for FI23143.complete
Subject Subject Range Query Range Percent Splice Strand
BG642312-RA 1..234 152..385 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:24:04 Download gff for FI23143.complete
Subject Subject Range Query Range Percent Splice Strand
BG642312-RA 1..234 152..385 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-12 14:18:01 Download gff for FI23143.complete
Subject Subject Range Query Range Percent Splice Strand
BG642312-RA 1..540 1..540 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:24:04 Download gff for FI23143.complete
Subject Subject Range Query Range Percent Splice Strand
BG642312-RA 1..540 1..540 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:19:11 Download gff for FI23143.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6232469..6232772 237..540 100 <- Minus
3L 6232837..6232990 83..236 100 <- Minus
3L 6233300..6233381 1..82 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:19:11 Download gff for FI23143.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6232469..6232772 237..540 100 <- Minus
3L 6232837..6232990 83..236 100 <- Minus
3L 6233300..6233381 1..82 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:19:11 Download gff for FI23143.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6232469..6232772 237..540 100 <- Minus
3L 6232837..6232990 83..236 100 <- Minus
3L 6233300..6233381 1..82 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-12 14:18:01 Download gff for FI23143.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6225569..6225872 237..540 100 <- Minus
arm_3L 6225937..6226090 83..236 100 <- Minus
arm_3L 6226400..6226481 1..82 100   Minus

FI23143.pep Sequence

Translation from 151 to 384

> FI23143.pep
MPINRINPSTAMRSASLKFYLICLLVICVIGWSAGAPSPQLSRKELEDRY
RQKPPVPDERDADAELDSAYDRNTRRP*

FI23143.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 00:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10907-PA 80 GF10907-PA 1..70 12..77 187 55.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 00:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14067-PA 66 GG14067-PA 1..66 12..77 313 87.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
BG642312-PB 77 CG33943-PB 1..77 1..77 404 100 Plus
BG642312-PA 77 CG33943-PA 1..77 1..77 404 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 00:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13849-PA 77 GM13849-PA 1..77 1..77 378 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 00:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13134-PA 77 GD13134-PA 1..77 1..77 368 90.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 00:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20492-PA 74 GE20492-PA 1..74 1..77 286 75.3 Plus

FI23143.hyp Sequence

Translation from 151 to 384

> FI23143.hyp
MPINRINPSTAMRSASLKFYLICLLVICVIGWSAGAPSPQLSRKELEDRY
RQKPPVPDERDADAELDSAYDRNTRRP*

FI23143.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
BG642312-PB 77 CG33943-PB 1..77 1..77 404 100 Plus
BG642312-PA 77 CG33943-PA 1..77 1..77 404 100 Plus