Clone GH01072 Report

Search the DGRC for GH01072

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:10
Well:72
Vector:pOT2
Associated Gene/TranscriptMED11-RA
Protein status:GH01072.pep: gold
Preliminary Size:884
Sequenced Size:723

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6884 2002-01-01 Sim4 clustering to Release 2
CG6884 2002-05-01 Blastp of sequenced clone
CG6884 2003-01-01 Sim4 clustering to Release 3
MED11 2008-04-29 Release 5.5 accounting
MED11 2008-08-15 Release 5.9 accounting
MED11 2008-12-18 5.12 accounting

Clone Sequence Records

GH01072.complete Sequence

723 bp (723 high quality bases) assembled on 2002-05-01

GenBank Submission: AY102649

> GH01072.complete
AATGAATCCTCTGGACAAAATACACGCTCTAGATGAGATCGAAAAGGAGA
TAATCCTGTGCATGCAAAGTGCAGGACAAGCCTTGCAGGAGTTGGGCAAG
GAAAAGTCTTCCCAGAAAAATGCGGAGACCCAGTCGCAGCAGTTTCTCAA
GAGTCTGTCCAGCGTGGAATCGAAGCTGTCCGAGCAGATCAACTACTTGA
CCCAGGTGTCCACGGGTCAGCCACACGAGGGTTCCGGCTATGCATCCGCC
AAAGTGCTCCAAATGGCTTGGCATCGCATTCAGCACGCTAGGTCCAGAGT
GCGTGAACTTGAGGAAACTAAGGCCAAACACTCACATGCAGCTCGTCAGC
AGTTGAAGCGTCAGCAGGAACATGCCGCCGCCCAGCAACAGCAGCAGCAA
CAACAACAGCAGCAGCAGCAACAACAACAGATGCAACAGGCGGCACAACA
GCAGCAACAACAAACCGGAGGAGGAAATGCCGGCAGCGGAGATCATCCCA
TGGGCGGAGACTCCTCAATGTCAACCAACTAATCTTGCGCTATCTTTAAG
GGTAAGGGTTTTAAATTTTTTAGAGTGCATTCCGAAAAGGCACATTTTGT
CAACCAATTGCGTTAATCGAAACATAAGTGACACTCTTTTTAAGAAATAC
ATTTGCATACTACTATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

GH01072.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
MED11-RA 809 MED11-RA 143..809 1..667 3335 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18735655..18736253 72..667 2795 98.2 Plus
chr3L 24539361 chr3L 18735529..18735603 1..75 375 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:25:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:43:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18746028..18746623 72..667 2980 100 Plus
3L 28110227 3L 18745902..18745976 1..75 375 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18739128..18739723 72..667 2980 100 Plus
3L 28103327 3L 18739002..18739076 1..75 375 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:43:46 has no hits.

GH01072.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:44:53 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18735529..18735602 1..74 100 -> Plus
chr3L 18735658..18735964 75..381 99 == Plus
chr3L 18736049..18736253 463..667 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:01:48 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
MED11-RA 1..531 2..532 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:54:01 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
MED11-RA 1..531 2..532 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:37:34 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
MED11-RA 1..531 2..532 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:31 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
MED11-RA 1..531 2..532 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:13:39 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
MED11-RA 1..531 2..532 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:32:37 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
MED11-RA 1..662 1..662 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:54:01 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
MED11-RA 1..662 1..662 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:37:34 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
MED11-RA 47..713 1..667 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:31 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
MED11-RA 1..662 1..662 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:13:39 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
MED11-RA 47..713 1..667 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:44:53 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18745902..18745975 1..74 100 -> Plus
3L 18746031..18746623 75..667 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:44:53 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18745902..18745975 1..74 100 -> Plus
3L 18746031..18746623 75..667 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:44:53 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18745902..18745975 1..74 100 -> Plus
3L 18746031..18746623 75..667 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:37:34 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18739002..18739075 1..74 100 -> Plus
arm_3L 18739131..18739723 75..667 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:19:06 Download gff for GH01072.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18739131..18739723 75..667 100   Plus
3L 18739002..18739075 1..74 100 -> Plus

GH01072.hyp Sequence

Translation from 1 to 531

> GH01072.hyp
MNPLDKIHALDEIEKEIILCMQSAGQALQELGKEKSSQKNAETQSQQFLK
SLSSVESKLSEQINYLTQVSTGQPHEGSGYASAKVLQMAWHRIQHARSRV
RELEETKAKHSHAARQQLKRQQEHAAAQQQQQQQQQQQQQQQQMQQAAQQ
QQQQTGGGNAGSGDHPMGGDSSMSTN*

GH01072.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:13:37
Subject Length Description Subject Range Query Range Score Percent Strand
MED11-PA 176 CG6884-PA 1..176 1..176 889 100 Plus
btd-PA 644 CG12653-PA 18..89 83..154 153 50.7 Plus
psq-PK 639 CG2368-PK 56..186 55..169 151 35 Plus
psq-PJ 639 CG2368-PJ 56..186 55..169 151 35 Plus
psq-PF 645 CG2368-PF 62..192 55..169 151 35 Plus

GH01072.pep Sequence

Translation from 1 to 531

> GH01072.pep
MNPLDKIHALDEIEKEIILCMQSAGQALQELGKEKSSQKNAETQSQQFLK
SLSSVESKLSEQINYLTQVSTGQPHEGSGYASAKVLQMAWHRIQHARSRV
RELEETKAKHSHAARQQLKRQQEHAAAQQQQQQQQQQQQQQQQMQQAAQQ
QQQQTGGGNAGSGDHPMGGDSSMSTN*

GH01072.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:25:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23639-PA 179 GF23639-PA 1..179 1..176 625 88.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13675-PA 174 GG13675-PA 1..174 1..176 846 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14372-PA 183 GH14372-PA 1..112 1..112 580 98.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:37
Subject Length Description Subject Range Query Range Score Percent Strand
MED11-PA 176 CG6884-PA 1..176 1..176 889 100 Plus
btd-PA 644 CG12653-PA 18..89 83..154 153 50.7 Plus
psq-PK 639 CG2368-PK 56..186 55..169 151 35 Plus
psq-PJ 639 CG2368-PJ 56..186 55..169 151 35 Plus
psq-PF 645 CG2368-PF 62..192 55..169 151 35 Plus
psq-PG 645 CG2368-PG 62..192 55..169 151 35 Plus
psq-PD 645 CG2368-PD 62..192 55..169 151 35 Plus
psq-PH 645 CG2368-PH 62..192 55..169 151 35 Plus
psq-PE 645 CG2368-PE 62..192 55..169 151 35 Plus
psq-PN 1043 CG2368-PN 481..611 55..169 151 35 Plus
psq-PA 1046 CG2368-PA 481..611 55..169 151 35 Plus
psq-PB 1064 CG2368-PB 481..611 55..169 151 35 Plus
psq-PC 1064 CG2368-PC 481..611 55..169 151 35 Plus
psq-PM 1123 CG2368-PM 481..611 55..169 151 35 Plus
Tomosyn-PJ 1254 CG17762-PJ 688..748 113..175 151 54 Plus
Tomosyn-PH 1254 CG17762-PH 688..748 113..175 151 54 Plus
Tomosyn-PL 1387 CG17762-PL 688..748 113..175 151 54 Plus
Tomosyn-PK 1387 CG17762-PK 688..748 113..175 151 54 Plus
Smr-PF 3601 CG4013-PF 133..269 22..175 151 30.3 Plus
Smr-PE 3601 CG4013-PE 133..269 22..175 151 30.3 Plus
Smr-PD 3601 CG4013-PD 133..269 22..175 151 30.3 Plus
Ptip-PA 2294 CG32133-PA 201..260 94..153 149 50 Plus
Smr-PG 3607 CG4013-PG 134..275 33..175 148 29.6 Plus
ASPP-PA 1020 CG18375-PA 102..255 2..154 146 32.7 Plus
ASPP-PC 1046 CG18375-PC 102..255 2..154 146 32.7 Plus
ASPP-PB 1069 CG18375-PB 151..304 2..154 146 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11315-PA 181 GI11315-PA 1..114 1..114 588 97.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24880-PA 181 GL24880-PA 1..181 1..176 599 84 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19929-PA 181 GA19929-PA 1..181 1..176 599 84 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14990-PA 190 GM14990-PA 1..126 1..127 542 84.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14767-PA 176 GD14767-PA 1..176 1..176 880 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11572-PA 189 GJ11572-PA 1..124 1..124 583 97.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12088-PA 207 GK12088-PA 1..124 1..124 595 99.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19972-PA 176 GE19972-PA 1..176 1..176 862 97.7 Plus