Clone GH01142 Report

Search the DGRC for GH01142

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:11
Well:42
Vector:pOT2
Associated Gene/TranscriptCG11400-RA
Protein status:GH01142.pep: gold
Preliminary Size:945
Sequenced Size:727

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11400 2002-01-01 Sim4 clustering to Release 2
CG11400 2002-06-07 Blastp of sequenced clone
CG11400 2003-01-01 Sim4 clustering to Release 3
CG11400 2008-04-29 Release 5.5 accounting
CG11400 2008-08-15 Release 5.9 accounting
CG11400 2008-12-18 5.12 accounting

Clone Sequence Records

GH01142.complete Sequence

727 bp (727 high quality bases) assembled on 2002-06-07

GenBank Submission: AY119454

> GH01142.complete
TGAACGTGTTTACTTGGGCTTCGATTGCGAATACACAAAACCAACTTTAC
GATGGCAATTACGCGGCGGCTTCCCTGGCCGAAGCTGCTGTTTTTGTTTG
TCTGGCTGTGTCTGTCATTGGATACAAATCGTGCAGCTCGAGTGCCCAGC
GATCAGTTTGTGTTTCCCTCGGAGTCCAAGCCAAATGCCACAGCCATCCG
ACTGGAATCCAGACTTAAGGAAATCGAGCGAGAAATGGCGGAGGTGACTA
GAGCCACAAATGTAAATCTACCAATCCTCAAAGAAATCAAAAAGGGCACA
CCGAGAACTACGGCTAACGACAACAAGCATGAGTCACCGGCAAATACTAC
CAATGATTCGAAAAACTTGACCGAACCACAGGGAAACTCATCAACACAAG
AGATTAAAATGAACGATGTGCCCAGCATTTCGAAAAATCATGCACATCCT
TCCAGCGAGTCCAAGATGATAACCTTCGGCCAGGAATCTAGTTCAGATAA
GCCAGCGCCTTGGGATCATACGGAAGCCACCAATGCTAGCAGTGCCACTA
GTGTGGTTATTGGGCCAAGGATTGTCCTGGAAACAACGCGAATTTGTCCA
CAGGGCACTACTCTGACCGTAAATGATCATTGCCGAAAAATTGCCTAGAT
TAGTGCCATAAAACTGGGAACAACTGAGAATTAATTAACAAAAATTAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAA

GH01142.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:54:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG11400-RA 689 CG11400-RA 1..689 1..689 3445 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13021340..13022035 1..696 3315 98.4 Plus
chr2R 21145070 chr2R 13022963..13023118 21..176 645 94.2 Plus
chr2R 21145070 chr2R 13023120..13023301 514..695 565 87.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:25:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17134157..17134862 1..706 3530 100 Plus
2R 25286936 2R 17135780..17135935 21..176 630 93.6 Plus
2R 25286936 2R 17135937..17136118 514..695 535 86.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17135356..17136061 1..706 3530 100 Plus
2R 25260384 2R 17136979..17137134 21..176 630 93.5 Plus
2R 25260384 2R 17137136..17137317 514..695 535 86.2 Plus
Blast to na_te.dros performed on 2019-03-16 10:18:41 has no hits.

GH01142.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:19:39 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13021340..13022016 1..677 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:02:29 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
CG11400-RA 1..597 52..648 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:51:16 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
CG11400-RA 1..597 52..648 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:59:52 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
CG11400-RA 1..597 52..648 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:33:30 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
CG11400-RA 1..597 52..648 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:04:51 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
CG11400-RA 1..597 52..648 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:02:28 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
CG11400-RA 1..689 1..689 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:51:16 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
CG11400-RA 1..696 1..696 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:59:52 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
CG11400-RA 29..724 1..696 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:33:30 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
CG11400-RA 1..689 1..689 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:04:51 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
CG11400-RA 29..724 1..696 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:19:39 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17134157..17134852 1..696 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:19:39 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17134157..17134852 1..696 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:19:39 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17134157..17134852 1..696 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:59:52 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13021662..13022357 1..696 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:14:23 Download gff for GH01142.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17135356..17136051 1..696 100   Plus

GH01142.hyp Sequence

Translation from 51 to 647

> GH01142.hyp
MAITRRLPWPKLLFLFVWLCLSLDTNRAARVPSDQFVFPSESKPNATAIR
LESRLKEIEREMAEVTRATNVNLPILKEIKKGTPRTTANDNKHESPANTT
NDSKNLTEPQGNSSTQEIKMNDVPSISKNHAHPSSESKMITFGQESSSDK
PAPWDHTEATNASSATSVVIGPRIVLETTRICPQGTTLTVNDHCRKIA*

GH01142.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG11400-PB 198 CG11400-PB 1..198 1..198 1026 100 Plus
CG11400-PA 198 CG11400-PA 1..198 1..198 1026 100 Plus

GH01142.pep Sequence

Translation from 51 to 647

> GH01142.pep
MAITRRLPWPKLLFLFVWLCLSLDTNRAARVPSDQFVFPSESKPNATAIR
LESRLKEIEREMAEVTRATNVNLPILKEIKKGTPRTTANDNKHESPANTT
NDSKNLTEPQGNSSTQEIKMNDVPSISKNHAHPSSESKMITFGQESSSDK
PAPWDHTEATNASSATSVVIGPRIVLETTRICPQGTTLTVNDHCRKIA*

GH01142.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11444-PA 144 GF11444-PA 2..144 48..198 266 43.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20665-PA 197 GG20665-PA 1..197 1..198 814 80.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG11400-PB 198 CG11400-PB 1..198 1..198 1026 100 Plus
CG11400-PA 198 CG11400-PA 1..198 1..198 1026 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17238-PA 179 GL17238-PA 1..179 1..198 168 36.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10978-PA 179 GA10978-PA 1..179 1..198 173 37.4 Plus
Dpse\GA22235-PA 179 GA22235-PA 23..179 24..198 170 35.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21761-PA 192 GM21761-PA 1..192 1..198 913 88.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Acp54A1-PA 192 GD11252-PA 1..192 1..198 916 89.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11650-PA 69 GE11650-PA 1..69 139..198 202 62.3 Plus