GH01142.complete Sequence
727 bp (727 high quality bases) assembled on 2002-06-07
GenBank Submission: AY119454
> GH01142.complete
TGAACGTGTTTACTTGGGCTTCGATTGCGAATACACAAAACCAACTTTAC
GATGGCAATTACGCGGCGGCTTCCCTGGCCGAAGCTGCTGTTTTTGTTTG
TCTGGCTGTGTCTGTCATTGGATACAAATCGTGCAGCTCGAGTGCCCAGC
GATCAGTTTGTGTTTCCCTCGGAGTCCAAGCCAAATGCCACAGCCATCCG
ACTGGAATCCAGACTTAAGGAAATCGAGCGAGAAATGGCGGAGGTGACTA
GAGCCACAAATGTAAATCTACCAATCCTCAAAGAAATCAAAAAGGGCACA
CCGAGAACTACGGCTAACGACAACAAGCATGAGTCACCGGCAAATACTAC
CAATGATTCGAAAAACTTGACCGAACCACAGGGAAACTCATCAACACAAG
AGATTAAAATGAACGATGTGCCCAGCATTTCGAAAAATCATGCACATCCT
TCCAGCGAGTCCAAGATGATAACCTTCGGCCAGGAATCTAGTTCAGATAA
GCCAGCGCCTTGGGATCATACGGAAGCCACCAATGCTAGCAGTGCCACTA
GTGTGGTTATTGGGCCAAGGATTGTCCTGGAAACAACGCGAATTTGTCCA
CAGGGCACTACTCTGACCGTAAATGATCATTGCCGAAAAATTGCCTAGAT
TAGTGCCATAAAACTGGGAACAACTGAGAATTAATTAACAAAAATTAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAA
GH01142.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:54:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11400-RA | 689 | CG11400-RA | 1..689 | 1..689 | 3445 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:18:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 13021340..13022035 | 1..696 | 3315 | 98.4 | Plus |
chr2R | 21145070 | chr2R | 13022963..13023118 | 21..176 | 645 | 94.2 | Plus |
chr2R | 21145070 | chr2R | 13023120..13023301 | 514..695 | 565 | 87.4 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:25:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:18:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 17134157..17134862 | 1..706 | 3530 | 100 | Plus |
2R | 25286936 | 2R | 17135780..17135935 | 21..176 | 630 | 93.6 | Plus |
2R | 25286936 | 2R | 17135937..17136118 | 514..695 | 535 | 86.3 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:13:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 17135356..17136061 | 1..706 | 3530 | 100 | Plus |
2R | 25260384 | 2R | 17136979..17137134 | 21..176 | 630 | 93.5 | Plus |
2R | 25260384 | 2R | 17137136..17137317 | 514..695 | 535 | 86.2 | Plus |
Blast to na_te.dros performed on 2019-03-16 10:18:41 has no hits.
GH01142.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:19:39 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 13021340..13022016 | 1..677 | 98 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:02:29 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11400-RA | 1..597 | 52..648 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:51:16 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11400-RA | 1..597 | 52..648 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:59:52 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11400-RA | 1..597 | 52..648 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:33:30 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11400-RA | 1..597 | 52..648 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:04:51 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11400-RA | 1..597 | 52..648 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:02:28 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11400-RA | 1..689 | 1..689 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:51:16 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11400-RA | 1..696 | 1..696 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:59:52 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11400-RA | 29..724 | 1..696 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:33:30 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11400-RA | 1..689 | 1..689 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:04:51 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11400-RA | 29..724 | 1..696 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:19:39 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17134157..17134852 | 1..696 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:19:39 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17134157..17134852 | 1..696 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:19:39 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17134157..17134852 | 1..696 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:59:52 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 13021662..13022357 | 1..696 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:14:23 Download gff for
GH01142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17135356..17136051 | 1..696 | 100 | | Plus |
GH01142.hyp Sequence
Translation from 51 to 647
> GH01142.hyp
MAITRRLPWPKLLFLFVWLCLSLDTNRAARVPSDQFVFPSESKPNATAIR
LESRLKEIEREMAEVTRATNVNLPILKEIKKGTPRTTANDNKHESPANTT
NDSKNLTEPQGNSSTQEIKMNDVPSISKNHAHPSSESKMITFGQESSSDK
PAPWDHTEATNASSATSVVIGPRIVLETTRICPQGTTLTVNDHCRKIA*
GH01142.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:15:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11400-PB | 198 | CG11400-PB | 1..198 | 1..198 | 1026 | 100 | Plus |
CG11400-PA | 198 | CG11400-PA | 1..198 | 1..198 | 1026 | 100 | Plus |
GH01142.pep Sequence
Translation from 51 to 647
> GH01142.pep
MAITRRLPWPKLLFLFVWLCLSLDTNRAARVPSDQFVFPSESKPNATAIR
LESRLKEIEREMAEVTRATNVNLPILKEIKKGTPRTTANDNKHESPANTT
NDSKNLTEPQGNSSTQEIKMNDVPSISKNHAHPSSESKMITFGQESSSDK
PAPWDHTEATNASSATSVVIGPRIVLETTRICPQGTTLTVNDHCRKIA*
GH01142.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:59:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF11444-PA | 144 | GF11444-PA | 2..144 | 48..198 | 266 | 43.4 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:59:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG20665-PA | 197 | GG20665-PA | 1..197 | 1..198 | 814 | 80.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11400-PB | 198 | CG11400-PB | 1..198 | 1..198 | 1026 | 100 | Plus |
CG11400-PA | 198 | CG11400-PA | 1..198 | 1..198 | 1026 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:59:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL17238-PA | 179 | GL17238-PA | 1..179 | 1..198 | 168 | 36.9 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:59:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA10978-PA | 179 | GA10978-PA | 1..179 | 1..198 | 173 | 37.4 | Plus |
Dpse\GA22235-PA | 179 | GA22235-PA | 23..179 | 24..198 | 170 | 35.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:59:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM21761-PA | 192 | GM21761-PA | 1..192 | 1..198 | 913 | 88.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:59:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\Acp54A1-PA | 192 | GD11252-PA | 1..192 | 1..198 | 916 | 89.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:59:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE11650-PA | 69 | GE11650-PA | 1..69 | 139..198 | 202 | 62.3 | Plus |