Clone GH01257 Report

Search the DGRC for GH01257

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:12
Well:57
Vector:pOT2
Associated Gene/TranscriptCG5107-RA
Protein status:GH01257.pep: gold
Preliminary Size:820
Sequenced Size:677

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5107 2001-01-01 Release 2 assignment
CG5107 2001-11-29 Blastp of sequenced clone
CG5107 2003-01-01 Sim4 clustering to Release 3
CG5107 2008-04-29 Release 5.5 accounting
CG5107 2008-08-15 Release 5.9 accounting
CG5107 2008-12-18 5.12 accounting

Clone Sequence Records

GH01257.complete Sequence

677 bp (677 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069029

> GH01257.complete
TAAAATGAAAGCCATCACCGTTTGCCTTTTGGTTCTGGTTTCGGCCACCT
GTCTGCTGACCACGCGGGCCAATGCAATAGAATTGCTGGAGAACGAGAAC
TTCGACTATGATTTCGACTTTGAATCGGAATTGGAGCAGTTGCTGGATGA
ACTGGACAATGACACTGACTACATGGATGTGGAGGCACAGGGCTTTATTA
GAACATGCCTTAAAATCCTTCGCAAGGCATTGAAAACGGTTCGAGGCACC
AACTGTATTATCAAGGAGGTGACAAACATCCTTAGTTCATGCACCAGCTA
TGTGGATGCTATTGATGCCTGTGGCACTGCCATTCCCAAGGATGTGGCCA
AGATTGTGGACTCCGTTAAGGAGATTATCAAAATCTGCGACGATATTTTG
CATCTGCATTCGAAACTTTGTGCCACGGATAAGTCCGTGGGCTCGTCCAT
CAAAAACTCGGCCAAATGCTTCTGGAAATTGTTCAAGGCATCCATGAGGC
TGACCCGAAAGATCAATAAAACCCTAAAACTGATTGCCAAATTGCCAGCC
GATACCAGTTCCTGCTTCGTAAATGCCACCAATAAAGTTACAGCGTCCTT
TAACTCTTTTCTGCCCAACATTGATGTCTGCATCGAGTCTATGTAAATAT
ATTATTATTAAAAAAAAAAAAAAAAAA

GH01257.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG5107-RA 883 CG5107-RA 124..795 1..672 3345 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21328458..21329050 67..659 2845 98.7 Plus
chr3R 27901430 chr3R 21328332..21328399 1..68 340 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:25:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25505339..25505944 67..672 3015 99.8 Plus
3R 32079331 3R 25505213..25505280 1..68 340 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25246170..25246775 67..672 3015 99.8 Plus
3R 31820162 3R 25246044..25246111 1..68 340 100 Plus
Blast to na_te.dros performed on 2019-03-17 00:05:32 has no hits.

GH01257.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:06:28 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21328332..21328398 1..67 100 -> Plus
chr3R 21328459..21329050 68..659 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:02:58 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
CG5107-RA 1..642 5..646 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:27:22 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
CG5107-RA 1..642 5..646 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:57:19 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
CG5107-RA 1..642 5..646 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:54:56 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
CG5107-RA 1..642 5..646 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:10:30 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
CG5107-RA 1..642 5..646 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:04:11 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
CG5107-RA 1..646 1..646 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:27:22 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
CG5107-RA 1..659 1..659 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:57:19 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
CG5107-RA 1..659 1..659 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:54:56 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
CG5107-RA 1..646 1..646 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:10:30 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
CG5107-RA 23..681 1..659 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:06:28 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25505213..25505279 1..67 100 -> Plus
3R 25505340..25505931 68..659 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:06:28 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25505213..25505279 1..67 100 -> Plus
3R 25505340..25505931 68..659 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:06:28 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25505213..25505279 1..67 100 -> Plus
3R 25505340..25505931 68..659 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:57:19 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21330935..21331001 1..67 100 -> Plus
arm_3R 21331062..21331653 68..659 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:30:58 Download gff for GH01257.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25246171..25246762 68..659 100   Plus
3R 25246044..25246110 1..67 100 -> Plus

GH01257.hyp Sequence

Translation from 1 to 645

> GH01257.hyp
KMKAITVCLLVLVSATCLLTTRANAIELLENENFDYDFDFESELEQLLDE
LDNDTDYMDVEAQGFIRTCLKILRKALKTVRGTNCIIKEVTNILSSCTSY
VDAIDACGTAIPKDVAKIVDSVKEIIKICDDILHLHSKLCATDKSVGSSI
KNSAKCFWKLFKASMRLTRKINKTLKLIAKLPADTSSCFVNATNKVTASF
NSFLPNIDVCIESM*

GH01257.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG5107-PA 213 CG5107-PA 1..213 2..214 1084 100 Plus
CG8664-PB 214 CG8664-PB 1..213 2..214 415 43 Plus
CG8664-PA 214 CG8664-PA 1..213 2..214 415 43 Plus
CG8661-PA 198 CG8661-PA 31..193 50..210 231 32.1 Plus

GH01257.pep Sequence

Translation from 4 to 645

> GH01257.pep
MKAITVCLLVLVSATCLLTTRANAIELLENENFDYDFDFESELEQLLDEL
DNDTDYMDVEAQGFIRTCLKILRKALKTVRGTNCIIKEVTNILSSCTSYV
DAIDACGTAIPKDVAKIVDSVKEIIKICDDILHLHSKLCATDKSVGSSIK
NSAKCFWKLFKASMRLTRKINKTLKLIAKLPADTSSCFVNATNKVTASFN
SFLPNIDVCIESM*

GH01257.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17271-PA 212 GF17271-PA 1..212 1..213 726 75.1 Plus
Dana\GF17269-PA 215 GF17269-PA 1..212 1..209 599 58.4 Plus
Dana\GF22333-PA 209 GF22333-PA 1..205 1..213 396 40.5 Plus
Dana\GF22619-PA 190 GF22619-PA 45..185 72..209 165 30.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:18:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11410-PA 212 GG11410-PA 1..212 1..213 980 90.6 Plus
Dere\GG18190-PA 214 GG18190-PA 1..213 1..213 442 44.2 Plus
Dere\GG18188-PA 199 GG18188-PA 31..194 49..209 192 30.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12068-PA 204 GH12068-PA 1..204 1..213 605 56.8 Plus
Dgri\GH12643-PA 208 GH12643-PA 5..202 8..209 183 28.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG5107-PA 213 CG5107-PA 1..213 1..213 1084 100 Plus
CG8664-PB 214 CG8664-PB 1..213 1..213 415 43 Plus
CG8664-PA 214 CG8664-PA 1..213 1..213 415 43 Plus
CG8661-PA 198 CG8661-PA 31..193 49..209 231 32.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15559-PA 206 GI15559-PA 1..206 1..211 477 46 Plus
Dmoj\GI13194-PA 189 GI13194-PA 27..189 51..213 472 56.6 Plus
Dmoj\GI15040-PA 209 GI15040-PA 5..203 8..209 194 28.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19884-PA 208 GL19884-PA 1..208 1..213 649 65 Plus
Dper\GL19836-PA 200 GL19836-PA 27..195 44..209 200 31 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28269-PA 208 GA28269-PA 1..208 1..213 628 63.1 Plus
Dpse\GA21242-PA 200 GA21242-PA 27..195 44..209 195 30.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10249-PA 210 GM10249-PA 1..210 1..213 1000 92 Plus
Dsec\GM13324-PA 214 GM13324-PA 1..213 1..213 418 42.9 Plus
Dsec\GM13323-PA 198 GM13323-PA 31..193 49..209 199 30.9 Plus
Dsec\GM16341-PA 62 GM16341-PA 2..61 154..213 138 48.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21222-PA 212 GD21222-PA 1..212 1..213 1031 93.9 Plus
Dsim\GD15681-PA 198 GD15681-PA 31..193 49..209 205 31.5 Plus
Dsim\GD16053-PA 62 GD16053-PA 2..61 154..213 150 50 Plus
Dsim\GD20330-PA 62 GD20330-PA 2..61 154..213 144 48.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15171-PA 204 GJ15171-PA 1..204 1..213 626 60.5 Plus
Dvir\GJ11817-PA 184 GJ11817-PA 1..184 1..213 521 53.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25811-PA 212 GK25811-PA 1..212 1..213 623 58.2 Plus
Dwil\GK23759-PA 201 GK23759-PA 1..201 1..213 592 57.4 Plus
Dwil\GK25812-PA 214 GK25812-PA 1..214 1..213 574 55.5 Plus
Dwil\GK19214-PA 216 GK19214-PA 1..216 1..213 446 45.2 Plus
Dwil\GK23760-PA 206 GK23760-PA 1..203 1..211 356 37.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23606-PA 212 GE23606-PA 1..212 1..213 987 91.1 Plus
Dyak\GE15604-PA 219 GE15604-PA 1..218 1..213 422 43.2 Plus
Dyak\GE15603-PA 198 GE15603-PA 31..193 49..209 200 30.9 Plus