Clone GH01546 Report

Search the DGRC for GH01546

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:15
Well:46
Vector:pOT2
Associated Gene/Transcriptfbp-RA
Protein status:GH01546.pep: gold
Preliminary Size:1057
Sequenced Size:1129

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31692 2001-07-04 Blastp of sequenced clone
CG31692 2003-01-01 Sim4 clustering to Release 3
fbp 2008-04-29 Release 5.5 accounting
fbp 2008-08-15 Release 5.9 accounting
fbp 2008-12-18 5.12 accounting

Clone Sequence Records

GH01546.complete Sequence

1129 bp (1129 high quality bases) assembled on 2001-07-04

GenBank Submission: AY047506

> GH01546.complete
CCGTCGACCGCGGTTCGTTGTTTGTTTGCCAGAGTTTGTCGATTTGTTCC
AAAATGACCCAACAGAGGCCAGCTTTCGACTCCAATGCGATGACGCTGAC
GCGTTTCGTGCTGCAGGAGCAGCGAAAGTTCAAGAGCGCCACTGGCGATC
TCTCCCAGCTGCTCAACTCCATCCAGACCGCCATCAAGGCTACATCATCC
GCGGTGCGGAAGGCAGGTATCGCCAAGCTCCATGGATTCGCTGGCGACGT
GAATGTCCAAGGCGAGGAGGTCAAGAAACTGGACGTGCTCTCCAACGAGC
TGTTCATCAACATGCTGAAGTCATCCTATACCACATGTCTAATGGTTTCC
GAGGAGAACGAGAATGTGATCGAGGTGGAAGTGGAGAAACAGGGCAAATA
CATCGTGTGCTTCGATCCCTTGGATGGATCCTCCAACATAGACTGCCTGG
TGTCGATCGGTTCAATCTTCGCCATTTACCGCAAGAAAAGCGATGGTCCG
CCCACAGTGGAGGATGCACTGCAGCCCGGAAATCAGCTGGTGGCCGCCGG
CTACGCGCTATACGGTTCGGCCACAGCAATTGTCCTGGGTCTGGGTTCGG
GAGTGAATGGCTTCACTTATGACCCGGCCATCGGAGAGTTCGTGCTGACC
GATCCCAACATGCGGGTGCCGGAGAAGGGAAAGATATACTCTATCAACGA
GGGATATGCAGCGGATTGGGAGGATGGTGTCTTCAACTACATTGCGGCCA
AGAAGGATCCCGCCAAGGGAAAGCCCTATGGAGCGCGGTACGTGGGTTCC
ATGGTCGCGGATGTGCATCGCACCATTAAATACGGCGGCATCTTTATCTA
TCCGGCAACAAAGTCCGCTCCCAGCGGAAAACTTCGTCTGCTGTACGAGT
GCGTGCCCATGGCCTATCTGATGATCCAGGCTGGAGGTCTGGCCAGCGAC
GGAAAGATCAGCATTTTGGACATTGTGCCCAAGAAGATCCACGAGCGCAG
TCCCATATTCCTAGGATCCAAGTCCGACGTGGAGGAGGCACTTAGCTACT
TAAAGTGATTGTTGTGACTACAGTAACGTATCAATAAAGATCAATTATAT
TTTTTACTAAGAAAAAAAAAAAAAAAAAA

GH01546.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
fbp-RA 1297 fbp-RA 128..1241 1..1114 5570 100 Plus
fbp-RB 1278 fbp-RB 155..1222 47..1114 5340 100 Plus
fbp.a 1354 fbp.a 284..1349 49..1114 5330 100 Plus
fbp-RB 1278 fbp-RB 37..84 1..48 240 100 Plus
fbp.a 1354 fbp.a 22..69 1..48 240 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19760109..19760830 1111..390 3580 99.7 Minus
chr2L 23010047 chr2L 19761009..19761353 393..49 1710 99.7 Minus
chr2L 23010047 chr2L 19762592..19762639 48..1 240 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:26:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19761584..19762308 1114..390 3625 100 Minus
2L 23513712 2L 19762487..19762831 393..49 1725 100 Minus
2L 23513712 2L 19764070..19764117 48..1 240 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19761584..19762308 1114..390 3625 100 Minus
2L 23513712 2L 19762487..19762831 393..49 1725 100 Minus
2L 23513712 2L 19764070..19764117 48..1 240 100 Minus
Blast to na_te.dros performed 2019-03-16 17:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 3384..3449 507..571 110 68.7 Plus

GH01546.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:11:48 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19760109..19760827 393..1111 99 <- Minus
chr2L 19761010..19761353 49..392 99 <- Minus
chr2L 19762592..19762639 1..48 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:04:07 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RB 15..1032 40..1058 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:29:41 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RB 15..1032 40..1058 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:52:39 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RA 1..1005 54..1058 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:03:07 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RB 15..1032 40..1058 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:53:26 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RA 1..1005 54..1058 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:30:12 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RA 18..1128 1..1111 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:29:41 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RA 18..1128 1..1111 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:52:39 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RA 20..1130 1..1111 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:03:07 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RA 18..1128 1..1111 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:53:26 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
fbp-RA 20..1130 1..1111 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:11:48 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19761587..19762305 393..1111 100 <- Minus
2L 19762488..19762831 49..392 100 <- Minus
2L 19764070..19764117 1..48 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:11:48 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19761587..19762305 393..1111 100 <- Minus
2L 19762488..19762831 49..392 100 <- Minus
2L 19764070..19764117 1..48 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:11:48 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19761587..19762305 393..1111 100 <- Minus
2L 19762488..19762831 49..392 100 <- Minus
2L 19764070..19764117 1..48 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:52:39 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19761587..19762305 393..1111 100 <- Minus
arm_2L 19762488..19762831 49..392 100 <- Minus
arm_2L 19764070..19764117 1..48 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:41:08 Download gff for GH01546.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19761587..19762305 393..1111 100 <- Minus
2L 19762488..19762831 49..392 100 <- Minus
2L 19764070..19764117 1..48 100   Minus

GH01546.hyp Sequence

Translation from 2 to 1057

> GH01546.hyp
VDRGSLFVCQSLSICSKMTQQRPAFDSNAMTLTRFVLQEQRKFKSATGDL
SQLLNSIQTAIKATSSAVRKAGIAKLHGFAGDVNVQGEEVKKLDVLSNEL
FINMLKSSYTTCLMVSEENENVIEVEVEKQGKYIVCFDPLDGSSNIDCLV
SIGSIFAIYRKKSDGPPTVEDALQPGNQLVAAGYALYGSATAIVLGLGSG
VNGFTYDPAIGEFVLTDPNMRVPEKGKIYSINEGYAADWEDGVFNYIAAK
KDPAKGKPYGARYVGSMVADVHRTIKYGGIFIYPATKSAPSGKLRLLYEC
VPMAYLMIQAGGLASDGKISILDIVPKKIHERSPIFLGSKSDVEEALSYL
K*

GH01546.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
fbp-PE 334 CG31692-PE 1..334 18..351 1702 100 Plus
fbp-PA 334 CG31692-PA 1..334 18..351 1702 100 Plus
fbp-PD 322 CG31692-PD 1..322 30..351 1640 100 Plus
fbp-PC 322 CG31692-PC 1..322 30..351 1640 100 Plus

GH01546.pep Sequence

Translation from 53 to 1057

> GH01546.pep
MTQQRPAFDSNAMTLTRFVLQEQRKFKSATGDLSQLLNSIQTAIKATSSA
VRKAGIAKLHGFAGDVNVQGEEVKKLDVLSNELFINMLKSSYTTCLMVSE
ENENVIEVEVEKQGKYIVCFDPLDGSSNIDCLVSIGSIFAIYRKKSDGPP
TVEDALQPGNQLVAAGYALYGSATAIVLGLGSGVNGFTYDPAIGEFVLTD
PNMRVPEKGKIYSINEGYAADWEDGVFNYIAAKKDPAKGKPYGARYVGSM
VADVHRTIKYGGIFIYPATKSAPSGKLRLLYECVPMAYLMIQAGGLASDG
KISILDIVPKKIHERSPIFLGSKSDVEEALSYLK*

GH01546.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15476-PA 343 GF15476-PA 10..343 1..334 1611 94.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21609-PA 343 GG21609-PA 10..343 1..334 1732 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13045-PA 343 GH13045-PA 10..343 1..334 1565 90.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
fbp-PF 343 CG31692-PF 10..343 1..334 1702 100 Plus
fbp-PA 334 CG31692-PA 1..334 1..334 1702 100 Plus
fbp-PD 322 CG31692-PD 1..322 13..334 1640 100 Plus
fbp-PC 322 CG31692-PC 1..322 13..334 1640 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18191-PA 343 GI18191-PA 10..343 1..334 1590 92.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25621-PA 344 GL25621-PA 10..344 1..334 1646 92.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16400-PA 344 GA16400-PA 10..344 1..334 1646 92.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16988-PA 343 GM16988-PA 10..343 1..334 1746 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21735-PA 342 GD21735-PA 11..337 2..328 1723 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14680-PA 343 GJ14680-PA 10..343 1..334 1599 93.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15219-PA 344 GK15219-PA 10..344 1..334 1590 92.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12630-PA 343 GE12630-PA 10..343 1..334 1740 98.5 Plus