Clone GH01560 Report

Search the DGRC for GH01560

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:15
Well:60
Vector:pOT2
Associated Gene/TranscriptCG1545-RB
Protein status:GH01560.pep: gold
Preliminary Size:968
Sequenced Size:734

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1545 2002-01-01 Sim4 clustering to Release 2
CG1545 2002-05-16 Blastp of sequenced clone
CG1545 2003-01-01 Sim4 clustering to Release 3
CG1545 2008-04-29 Release 5.5 accounting
CG1545 2008-08-15 Release 5.9 accounting
CG1545 2008-12-18 5.12 accounting

Clone Sequence Records

GH01560.complete Sequence

734 bp (734 high quality bases) assembled on 2002-05-16

GenBank Submission: AY118721

> GH01560.complete
GCAGTTAAAACCGCGCCGAGACAGCCACGTATCGCATTCGAGGCATCCGA
AGGCGTCCAATAGCCACTAGATACATGGCAGGCTCAGGTTCCGAATCAAA
TTTATCTACAAATTCTGGCCCAGAATTCGATTCTGATTTTGGCGGCGGCG
GTTGTGTTTACGATTGTTGTGCAATGGCCAAATCGATAACAGAAACGAGA
ACCACAAATTCTACGGCGGCAACCATAACTGCAATACACACTCGCAAAAG
CACCACAACAATCGCATTTGTTCTGCTGTTAATCCTCTGCTGTTTATGTG
ATTACAACCATGGAAGCTGGGCATCGCAATGCTGGAAAAAGCACAATTCC
GGCTCGATCCAAACGCCAGATGGAGAATTTAAGCGACCCTTTGGCATACT
CTGCACATATCGCTGCTTTCTCTGGTTTCCGCCAATTTATCCGTACTGTG
AATTCATATTCGATCTGCGCTTATCGAGGCACTTCACATCCTTTCCGGAC
TGCTACGAGATTCGCTGCAACGAGACCTTCTCCTTTTTCGGCAAGGAGCC
CCATTACTGACCTCCACCACCTGGAGGGTCAGTTGCTCAGCGTGTGAGCA
ACTGACATTCCACATCCCCTTCCTTTTTTTTTTTTTTGAGTACTATCTGT
GACTAAGAATTGTATGCTTCAATAAATATGGGTTACTGCATAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH01560.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG1545-RB 748 CG1545-RB 47..742 1..695 3440 99.8 Plus
CG1545.a 748 CG1545.a 47..742 1..695 3440 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10950544..10950859 316..1 1580 100 Minus
chrX 22417052 chrX 10948809..10949065 691..437 1220 99.2 Minus
chrX 22417052 chrX 10949630..10949750 436..316 605 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:26:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11059279..11059594 316..1 1580 100 Minus
X 23542271 X 11057541..11057800 695..437 1250 99.6 Minus
X 23542271 X 11058365..11058485 436..316 605 100 Minus
X 23542271 X 10316236..10316287 731..680 245 98.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11067377..11067692 316..1 1580 100 Minus
X 23527363 X 11065639..11065898 695..437 1260 99.6 Minus
X 23527363 X 11066463..11066583 436..316 605 100 Minus
X 23527363 X 10324334..10324385 731..680 245 98 Minus
Blast to na_te.dros performed on 2019-03-16 09:46:21 has no hits.

GH01560.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:47:07 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10948809..10949065 437..691 99 <- Minus
chrX 10949630..10949750 316..436 100 <- Minus
chrX 10950545..10950859 1..315 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:04:10 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1545-RB 1..387 174..560 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:55:47 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1545-RB 1..387 174..560 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:59:28 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1545-RB 1..387 174..560 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:20:38 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1545-RB 1..387 174..560 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:45:26 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1545-RB 1..387 174..560 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:19:42 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1545-RB 26..717 1..691 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:55:46 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1545-RB 26..717 1..691 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:59:28 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1545-RB 26..717 1..691 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:20:38 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1545-RB 26..717 1..691 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:45:26 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
CG1545-RB 26..717 1..691 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:47:07 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
X 11057545..11057800 437..691 99 <- Minus
X 11058365..11058485 316..436 100 <- Minus
X 11059280..11059594 1..315 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:47:07 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
X 11057545..11057800 437..691 99 <- Minus
X 11058365..11058485 316..436 100 <- Minus
X 11059280..11059594 1..315 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:47:07 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
X 11057545..11057800 437..691 99 <- Minus
X 11058365..11058485 316..436 100 <- Minus
X 11059280..11059594 1..315 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:59:28 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10951578..10951833 437..691 99 <- Minus
arm_X 10952398..10952518 316..436 100 <- Minus
arm_X 10953313..10953627 1..315 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:55:15 Download gff for GH01560.complete
Subject Subject Range Query Range Percent Splice Strand
X 11065643..11065898 437..691 99 <- Minus
X 11066463..11066583 316..436 100 <- Minus
X 11067378..11067692 1..315 100   Minus

GH01560.pep Sequence

Translation from 74 to 559

> GH01560.pep
MAGSGSESNLSTNSGPEFDSDFGGGGCVYDCCAMAKSITETRTTNSTAAT
ITAIHTRKSTTTIAFVLLLILCCLCDYNHGSWASQCWKKHNSGSIQTPDG
EFKRPFGILCTYRCFLWFPPIYPYCEFIFDLRLSRHFTSFPDCYEIRCNE
TFSFFGKEPHY*

GH01560.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20399-PA 149 GF20399-PA 4..148 6..160 539 75 Plus
Dana\GF20398-PA 142 GF20398-PA 66..135 84..148 140 37.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:43:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18885-PA 84 GG18885-PA 5..84 82..161 441 100 Plus
Dere\GG18884-PA 138 GG18884-PA 62..131 84..148 140 37.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:43:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17596-PA 123 GH17596-PA 18..119 57..158 470 93.1 Plus
Dgri\GH17595-PA 140 GH17595-PA 64..133 84..148 146 38.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG1545-PB 128 CG1545-PB 1..128 34..161 724 100 Plus
CG1537-PA 135 CG1537-PA 59..128 84..148 148 37.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16462-PA 86 GI16462-PA 7..86 82..161 429 96.2 Plus
Dmoj\GI16460-PA 134 GI16460-PA 58..127 84..148 146 38.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18315-PA 109 GL18315-PA 5..109 17..121 350 71.3 Plus
Dper\GL18314-PA 133 GL18314-PA 57..126 84..148 142 37.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13738-PA 150 GA13738-PA 5..148 17..160 543 76.9 Plus
Dpse\GA13678-PA 133 GA13678-PA 57..126 84..148 142 37.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11268-PA 161 GM11268-PA 1..161 1..161 854 99.4 Plus
Dsec\GM11267-PA 135 GM11267-PA 59..128 84..148 140 37.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16004-PA 41 GD16004-PA 1..41 121..161 220 100 Plus
Dsim\GD16003-PA 135 GD16003-PA 59..128 84..148 140 37.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:43:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15939-PA 173 GJ15939-PA 28..173 20..161 515 81.5 Plus
Dvir\GJ15938-PA 141 GJ15938-PA 65..134 84..148 147 38.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:43:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19382-PA 144 GK19382-PA 3..144 17..161 566 81.4 Plus
Dwil\GK19896-PA 133 GK19896-PA 57..126 84..148 142 37.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17325-PA 161 GE17325-PA 1..161 1..161 837 97.5 Plus
Dyak\GE17324-PA 135 GE17324-PA 59..128 84..148 141 37.1 Plus

GH01560.hyp Sequence

Translation from 74 to 559

> GH01560.hyp
MAGSGSESNLSTNSGPEFDSDFGGGGCVYDCCAMAKSITETRTTNSTAAT
ITAIHTRKSTTTIAFVLLLILCCLCDYNHGSWASQCWKKHNSGSIQTPDG
EFKRPFGILCTYRCFLWFPPIYPYCEFIFDLRLSRHFTSFPDCYEIRCNE
TFSFFGKEPHY*

GH01560.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:19:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG1545-PB 128 CG1545-PB 1..128 34..161 724 100 Plus
CG1537-PA 135 CG1537-PA 59..128 84..148 148 37.1 Plus