Clone GH01635 Report

Search the DGRC for GH01635

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:16
Well:35
Vector:pOT2
Associated Gene/TranscriptCG9836-RA
Protein status:GH01635.pep: gold
Preliminary Size:937
Sequenced Size:960

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9836 2001-01-01 Release 2 assignment
CG9836 2001-09-19 Blastp of sequenced clone
CG9836 2003-01-01 Sim4 clustering to Release 3
CG9836 2008-04-29 Release 5.5 accounting
CG9836 2008-08-15 Release 5.9 accounting
CG9836 2008-12-18 5.12 accounting

Clone Sequence Records

GH01635.complete Sequence

960 bp (960 high quality bases) assembled on 2001-09-19

GenBank Submission: AY060228

> GH01635.complete
AGCTGTTTCTAACACGCAGTTGCCTGTGTTTTTTCGATCTCTTTGAATTT
CACAACAATTCTTCATTAAATTGATTTATTTAATTTAAATATGTCCCTGG
TGCGAAACTCCTCCCGGTTGCTGCGATCGCAGCTGAAGCGCGTACAAAGT
GTCCCGGTGGCATTGTATCATGAAAATGTCGTTGAGCACTACGAAAACCC
GCGCAACGTGGGATCTTTGGACAAGAAGGATGTCACTGTGGGCACCGGCT
TGGTCGGAGCACCAGCCTGCGGCGATGTGATGAAACTGCAGATCAAGGTG
GACGAGAACGGCAAGATAGTGGACGCCAAGTTCAAGACCTTCGGCTGTGG
ATCGGCCATTGCCAGCAGCTCCCTGGCCACCGAGTGGGTGAAGGGCAAGT
CCATCGACGAGGCCGGAAAGCTGAAGAATACGGACATCGCCAAGGAGCTG
CGTCTGCCGCCCGTCAAGCTGCATTGCTCCATGCTGGCCGAGGATGCCAT
CAAGGCGGCCCTGGCTGACTACAAGGTCAAGCAGCAGAAGAAGGTGGCCA
ACTGAGAGGCGGAACGGAATCTGTGAATGTAGTGGAGCGTTTCTCTGAAC
AACTACTAAAAAAAAAACAACTATAAGTACTCTACCATACAATACAATAC
CATATACTATATATTACTTGGCATTAGGTCGTAGTATGCGATTATTGTTC
GCTAGAGCTCTGTGAGTGATTGGCCGCGTGACTGCTGATAAGTGCATAGA
AGTTTAGGAATCGTCTGTCATTGATACTAAAGGATAGCTGGAACTGATCT
TGTATGAATGCATATGCACGTGTGTGTTTTGTAGGGGAATTCTAAGTAGT
CCCGAGAGCTAATTAAATTTTCCGTTCTGTTATGCGAAATACAAGCTTGT
GTCGAAAACAAATAAAGCGTTCCCGTTGGAATAAAAAATAAAAAAAAAAA
AAAAAAAAAA

GH01635.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG9836-RA 1006 CG9836-RA 13..952 1..940 4700 100 Plus
CG9836.b 951 CG9836.b 13..945 1..940 4570 99.2 Plus
CG9836.c 1018 CG9836.c 13..730 1..718 3590 100 Plus
CG9836.c 1018 CG9836.c 741..964 717..940 1120 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4649220..4649760 718..178 2690 99.8 Minus
chr3R 27901430 chr3R 4648808..4649029 939..718 1110 100 Minus
chr3R 27901430 chr3R 4649942..4650120 179..1 895 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:26:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8823261..8823801 718..178 2705 100 Minus
3R 32079331 3R 8822848..8823070 940..718 1115 100 Minus
3R 32079331 3R 8823983..8824161 179..1 895 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8564092..8564632 718..178 2705 100 Minus
3R 31820162 3R 8563679..8563901 940..718 1115 100 Minus
3R 31820162 3R 8564814..8564992 179..1 895 100 Minus
Blast to na_te.dros performed 2019-03-15 12:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Uvir 6564 Dvir\Uvir VIRUVIR 6564bp 4499..4661 516..667 122 59.4 Plus

GH01635.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:02:01 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4648808..4649028 719..939 100 <- Minus
chr3R 4649220..4649760 178..718 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:04:31 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
CG9836-RA 1..465 91..555 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:10:45 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
CG9836-RA 1..465 91..555 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:35:52 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
CG9836-RA 1..465 91..555 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:41:38 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
CG9836-RA 1..465 91..555 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:48:38 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
CG9836-RA 1..465 91..555 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:01:59 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
CG9836-RA 13..951 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:10:45 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
CG9836-RA 13..951 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:35:52 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
CG9836-RA 17..955 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:41:38 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
CG9836-RA 13..951 1..939 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:48:38 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
CG9836-RA 17..955 1..939 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:01 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8822849..8823069 719..939 100 <- Minus
3R 8823261..8823801 178..718 100 <- Minus
3R 8823985..8824161 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:01 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8822849..8823069 719..939 100 <- Minus
3R 8823261..8823801 178..718 100 <- Minus
3R 8823985..8824161 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:01 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8822849..8823069 719..939 100 <- Minus
3R 8823261..8823801 178..718 100 <- Minus
3R 8823985..8824161 1..177 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:35:52 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4648571..4648791 719..939 100 <- Minus
arm_3R 4648983..4649523 178..718 100 <- Minus
arm_3R 4649707..4649883 1..177 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:19:18 Download gff for GH01635.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8563680..8563900 719..939 100 <- Minus
3R 8564092..8564632 178..718 100 <- Minus
3R 8564816..8564992 1..177 100   Minus

GH01635.pep Sequence

Translation from 90 to 554

> GH01635.pep
MSLVRNSSRLLRSQLKRVQSVPVALYHENVVEHYENPRNVGSLDKKDVTV
GTGLVGAPACGDVMKLQIKVDENGKIVDAKFKTFGCGSAIASSSLATEWV
KGKSIDEAGKLKNTDIAKELRLPPVKLHCSMLAEDAIKAALADYKVKQQK
KVAN*

GH01635.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16826-PA 154 GF16826-PA 1..154 1..154 791 98.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17414-PA 154 GG17414-PA 1..154 1..154 800 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22664-PA 154 GH22664-PA 1..154 1..154 776 94.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
IscU-PA 154 CG9836-PA 1..154 1..154 776 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22712-PA 154 GI22712-PA 1..154 1..154 759 91.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22284-PA 154 GL22284-PA 1..154 1..154 777 95.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22065-PA 154 GA22065-PA 1..154 1..154 777 95.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26300-PA 154 GM26300-PA 1..154 1..154 805 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23436-PA 154 GJ23436-PA 1..154 1..154 764 93.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10917-PA 152 GK10917-PA 1..151 1..151 788 98.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24814-PA 154 GE24814-PA 1..154 1..154 801 98.7 Plus

GH01635.hyp Sequence

Translation from 90 to 554

> GH01635.hyp
MSLVRNSSRLLRSQLKRVQSVPVALYHENVVEHYENPRNVGSLDKKDVTV
GTGLVGAPACGDVMKLQIKVDENGKIVDAKFKTFGCGSAIASSSLATEWV
KGKSIDEAGKLKNTDIAKELRLPPVKLHCSMLAEDAIKAALADYKVKQQK
KVAN*

GH01635.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG9836-PA 154 CG9836-PA 1..154 1..154 776 100 Plus