Clone GH01760 Report

Search the DGRC for GH01760

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:17
Well:60
Vector:pOT2
Associated Gene/TranscriptOscp-RA
Protein status:GH01760.pep: gold
Preliminary Size:833
Sequenced Size:804

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4307 2001-01-01 Release 2 assignment
CG4307 2001-09-19 Blastp of sequenced clone
Oscp 2008-04-29 Release 5.5 accounting
Oscp 2008-08-15 Release 5.9 accounting
Oscp 2008-12-18 5.12 accounting

Clone Sequence Records

GH01760.complete Sequence

804 bp (804 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058261

> GH01760.complete
CCTGGTCACAGCTGAGATTTTTAGCTGAAAAATTGTCGGGATAAAAACGA
TGGCCTCTATTAACAAATTGGCACTTTTGAGCCGCACCCTCAGCTCCGCT
GCCGCCCAGGCGACGGTGAAGCCACCAGTGCAGGTGTTCGGTCTGGAGGG
TCGCTATGCTACCGCCCTGTATTCGGCTGCCTCCAAGTTGAGCCAGTTGG
ATCAGGTGGAGAAGGATCTGACGGCCCTGCAGGCCACCATCCGTAGCGAC
AAGAAGCTGCGCGAGTACGTGACCAGCCCCATCATCAACAAGAAGGTCAT
GGCCACCGCTCTGAAGGAGGCATCCGAGAAGCTCCGCTTCGCCCCGGCCA
CCGTCAATCTGTTGGGTCTGCTGGCTGACAACGGACGTCTAAAGAAGCTG
GACACCGTGATCAATGCCTACAAGACCATCATGGCCGCACATCGCGGTGA
GGTCGTCTGCGAGGTGGTCACCGCCAAGCCCTTGGATGCGTCCCAGAGCA
AGCAGCTGGAGGGTGCCCTTAAGTCTTTCCTGAAGGGCAACGAGTCTCTG
AAGATCACTTCCCGCGTGGACCCCAGCATCATTGGTGGCCTGATCGTTTC
CATTGGCGACAAGTACGTCGACATGAGCATTGCCACTAAGGTCAAGCTCT
ACACCGATGTCATCCAGACCGCTGCCTAGACTCTTAAGGATTTGCTCTTG
ATTTAGATGGTCAAACTGAAAGTTTGGTATTGGAATTCAAGCGGTAATAG
CGAATAAAACACTCTTCACCCTTTGAAAACCAAAAAAAAAAAAAAAAAAA
AAAA

GH01760.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Oscp-RA 1098 Oscp-RA 254..1041 1..788 3925 99.8 Plus
Oscp.a 1019 Oscp.a 194..981 1..788 3925 99.8 Plus
Oscp-RB 1121 Oscp-RB 355..1064 79..788 3535 99.8 Plus
Oscp-RB 1121 Oscp-RB 41..119 1..79 395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:17:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11090556..11091000 79..523 2225 100 Plus
chr3R 27901430 chr3R 11091061..11091320 522..781 1300 100 Plus
chr3R 27901430 chr3R 11090242..11090320 1..79 395 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:26:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:17:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15265926..15266370 79..523 2225 100 Plus
3R 32079331 3R 15266431..15266697 522..788 1320 99.6 Plus
3R 32079331 3R 15265612..15265690 1..79 395 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15006757..15007201 79..523 2225 100 Plus
3R 31820162 3R 15007262..15007528 522..788 1320 99.6 Plus
3R 31820162 3R 15006443..15006521 1..79 395 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:17:28 has no hits.

GH01760.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:18:20 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11090242..11090320 1..79 100 -> Plus
chr3R 11090557..11091000 80..523 100 -> Plus
chr3R 11091063..11091320 524..781 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:04:55 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 1..630 50..679 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:41:04 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 1..630 50..679 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:47:30 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 1..630 50..679 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:19:22 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 1..630 50..679 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:14:52 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 1..630 50..679 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:46:53 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 37..817 1..781 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:41:04 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 37..817 1..781 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:47:30 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 22..802 1..781 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:19:22 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 37..817 1..781 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:14:52 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
Oscp-RA 22..802 1..781 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:18:20 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15265612..15265690 1..79 100 -> Plus
3R 15265927..15266370 80..523 100 -> Plus
3R 15266433..15266690 524..781 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:18:20 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15265612..15265690 1..79 100 -> Plus
3R 15265927..15266370 80..523 100 -> Plus
3R 15266433..15266690 524..781 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:18:20 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15265612..15265690 1..79 100 -> Plus
3R 15265927..15266370 80..523 100 -> Plus
3R 15266433..15266690 524..781 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:47:30 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11092155..11092412 524..781 100   Plus
arm_3R 11091334..11091412 1..79 100 -> Plus
arm_3R 11091649..11092092 80..523 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:54:15 Download gff for GH01760.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15006758..15007201 80..523 100 -> Plus
3R 15007264..15007521 524..781 100   Plus
3R 15006443..15006521 1..79 100 -> Plus

GH01760.hyp Sequence

Translation from 49 to 678

> GH01760.hyp
MASINKLALLSRTLSSAAAQATVKPPVQVFGLEGRYATALYSAASKLSQL
DQVEKDLTALQATIRSDKKLREYVTSPIINKKVMATALKEASEKLRFAPA
TVNLLGLLADNGRLKKLDTVINAYKTIMAAHRGEVVCEVVTAKPLDASQS
KQLEGALKSFLKGNESLKITSRVDPSIIGGLIVSIGDKYVDMSIATKVKL
YTDVIQTAA*

GH01760.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
Oscp-PA 209 CG4307-PA 1..209 1..209 1004 100 Plus

GH01760.pep Sequence

Translation from 49 to 678

> GH01760.pep
MASINKLALLSRTLSSAAAQATVKPPVQVFGLEGRYATALYSAASKLSQL
DQVEKDLTALQATIRSDKKLREYVTSPIINKKVMATALKEASEKLRFAPA
TVNLLGLLADNGRLKKLDTVINAYKTIMAAHRGEVVCEVVTAKPLDASQS
KQLEGALKSFLKGNESLKITSRVDPSIIGGLIVSIGDKYVDMSIATKVKL
YTDVIQTAA*

GH01760.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11421-PA 209 GF11421-PA 1..209 1..209 988 90.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16904-PA 209 GG16904-PA 1..209 1..209 1058 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18853-PA 208 GH18853-PA 1..208 1..209 1009 93.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsynO-PA 209 CG4307-PA 1..209 1..209 1004 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22923-PA 209 GI22923-PA 1..209 1..209 979 90 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12538-PA 210 GL12538-PA 1..210 1..209 889 81 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18097-PA 210 GA18097-PA 1..210 1..209 886 81 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24212-PA 209 GM24212-PA 1..209 1..209 1065 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19002-PA 126 GD19002-PA 1..126 84..209 646 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23207-PA 209 GJ23207-PA 1..209 1..209 947 86.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13792-PA 208 GK13792-PA 1..208 1..209 1016 95.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24286-PA 209 GE24286-PA 1..209 1..209 1065 99 Plus