BDGP Sequence Production Resources |
Search the DGRC for GH01760
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 17 |
Well: | 60 |
Vector: | pOT2 |
Associated Gene/Transcript | Oscp-RA |
Protein status: | GH01760.pep: gold |
Preliminary Size: | 833 |
Sequenced Size: | 804 |
Gene | Date | Evidence |
---|---|---|
CG4307 | 2001-01-01 | Release 2 assignment |
CG4307 | 2001-09-19 | Blastp of sequenced clone |
Oscp | 2008-04-29 | Release 5.5 accounting |
Oscp | 2008-08-15 | Release 5.9 accounting |
Oscp | 2008-12-18 | 5.12 accounting |
804 bp (804 high quality bases) assembled on 2001-09-19
GenBank Submission: AY058261
> GH01760.complete CCTGGTCACAGCTGAGATTTTTAGCTGAAAAATTGTCGGGATAAAAACGA TGGCCTCTATTAACAAATTGGCACTTTTGAGCCGCACCCTCAGCTCCGCT GCCGCCCAGGCGACGGTGAAGCCACCAGTGCAGGTGTTCGGTCTGGAGGG TCGCTATGCTACCGCCCTGTATTCGGCTGCCTCCAAGTTGAGCCAGTTGG ATCAGGTGGAGAAGGATCTGACGGCCCTGCAGGCCACCATCCGTAGCGAC AAGAAGCTGCGCGAGTACGTGACCAGCCCCATCATCAACAAGAAGGTCAT GGCCACCGCTCTGAAGGAGGCATCCGAGAAGCTCCGCTTCGCCCCGGCCA CCGTCAATCTGTTGGGTCTGCTGGCTGACAACGGACGTCTAAAGAAGCTG GACACCGTGATCAATGCCTACAAGACCATCATGGCCGCACATCGCGGTGA GGTCGTCTGCGAGGTGGTCACCGCCAAGCCCTTGGATGCGTCCCAGAGCA AGCAGCTGGAGGGTGCCCTTAAGTCTTTCCTGAAGGGCAACGAGTCTCTG AAGATCACTTCCCGCGTGGACCCCAGCATCATTGGTGGCCTGATCGTTTC CATTGGCGACAAGTACGTCGACATGAGCATTGCCACTAAGGTCAAGCTCT ACACCGATGTCATCCAGACCGCTGCCTAGACTCTTAAGGATTTGCTCTTG ATTTAGATGGTCAAACTGAAAGTTTGGTATTGGAATTCAAGCGGTAATAG CGAATAAAACACTCTTCACCCTTTGAAAACCAAAAAAAAAAAAAAAAAAA AAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Oscp-RA | 1098 | Oscp-RA | 254..1041 | 1..788 | 3925 | 99.8 | Plus |
Oscp.a | 1019 | Oscp.a | 194..981 | 1..788 | 3925 | 99.8 | Plus |
Oscp-RB | 1121 | Oscp-RB | 355..1064 | 79..788 | 3535 | 99.8 | Plus |
Oscp-RB | 1121 | Oscp-RB | 41..119 | 1..79 | 395 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 11090556..11091000 | 79..523 | 2225 | 100 | Plus |
chr3R | 27901430 | chr3R | 11091061..11091320 | 522..781 | 1300 | 100 | Plus |
chr3R | 27901430 | chr3R | 11090242..11090320 | 1..79 | 395 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 15265926..15266370 | 79..523 | 2225 | 100 | Plus |
3R | 32079331 | 3R | 15266431..15266697 | 522..788 | 1320 | 99.6 | Plus |
3R | 32079331 | 3R | 15265612..15265690 | 1..79 | 395 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 15006757..15007201 | 79..523 | 2225 | 100 | Plus |
3R | 31820162 | 3R | 15007262..15007528 | 522..788 | 1320 | 99.6 | Plus |
3R | 31820162 | 3R | 15006443..15006521 | 1..79 | 395 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 11090242..11090320 | 1..79 | 100 | -> | Plus |
chr3R | 11090557..11091000 | 80..523 | 100 | -> | Plus |
chr3R | 11091063..11091320 | 524..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Oscp-RA | 1..630 | 50..679 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Oscp-RA | 1..630 | 50..679 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Oscp-RA | 1..630 | 50..679 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Oscp-RA | 1..630 | 50..679 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Oscp-RA | 1..630 | 50..679 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Oscp-RA | 37..817 | 1..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Oscp-RA | 37..817 | 1..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Oscp-RA | 22..802 | 1..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Oscp-RA | 37..817 | 1..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Oscp-RA | 22..802 | 1..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15265612..15265690 | 1..79 | 100 | -> | Plus |
3R | 15265927..15266370 | 80..523 | 100 | -> | Plus |
3R | 15266433..15266690 | 524..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15265612..15265690 | 1..79 | 100 | -> | Plus |
3R | 15265927..15266370 | 80..523 | 100 | -> | Plus |
3R | 15266433..15266690 | 524..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15265612..15265690 | 1..79 | 100 | -> | Plus |
3R | 15265927..15266370 | 80..523 | 100 | -> | Plus |
3R | 15266433..15266690 | 524..781 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 11092155..11092412 | 524..781 | 100 | Plus | |
arm_3R | 11091334..11091412 | 1..79 | 100 | -> | Plus |
arm_3R | 11091649..11092092 | 80..523 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15006758..15007201 | 80..523 | 100 | -> | Plus |
3R | 15007264..15007521 | 524..781 | 100 | Plus | |
3R | 15006443..15006521 | 1..79 | 100 | -> | Plus |
Translation from 49 to 678
> GH01760.hyp MASINKLALLSRTLSSAAAQATVKPPVQVFGLEGRYATALYSAASKLSQL DQVEKDLTALQATIRSDKKLREYVTSPIINKKVMATALKEASEKLRFAPA TVNLLGLLADNGRLKKLDTVINAYKTIMAAHRGEVVCEVVTAKPLDASQS KQLEGALKSFLKGNESLKITSRVDPSIIGGLIVSIGDKYVDMSIATKVKL YTDVIQTAA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Oscp-PA | 209 | CG4307-PA | 1..209 | 1..209 | 1004 | 100 | Plus |
Translation from 49 to 678
> GH01760.pep MASINKLALLSRTLSSAAAQATVKPPVQVFGLEGRYATALYSAASKLSQL DQVEKDLTALQATIRSDKKLREYVTSPIINKKVMATALKEASEKLRFAPA TVNLLGLLADNGRLKKLDTVINAYKTIMAAHRGEVVCEVVTAKPLDASQS KQLEGALKSFLKGNESLKITSRVDPSIIGGLIVSIGDKYVDMSIATKVKL YTDVIQTAA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11421-PA | 209 | GF11421-PA | 1..209 | 1..209 | 988 | 90.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16904-PA | 209 | GG16904-PA | 1..209 | 1..209 | 1058 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18853-PA | 208 | GH18853-PA | 1..208 | 1..209 | 1009 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ATPsynO-PA | 209 | CG4307-PA | 1..209 | 1..209 | 1004 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22923-PA | 209 | GI22923-PA | 1..209 | 1..209 | 979 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12538-PA | 210 | GL12538-PA | 1..210 | 1..209 | 889 | 81 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18097-PA | 210 | GA18097-PA | 1..210 | 1..209 | 886 | 81 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24212-PA | 209 | GM24212-PA | 1..209 | 1..209 | 1065 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19002-PA | 126 | GD19002-PA | 1..126 | 84..209 | 646 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23207-PA | 209 | GJ23207-PA | 1..209 | 1..209 | 947 | 86.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13792-PA | 208 | GK13792-PA | 1..208 | 1..209 | 1016 | 95.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24286-PA | 209 | GE24286-PA | 1..209 | 1..209 | 1065 | 99 | Plus |