Clone GH01773 Report

Search the DGRC for GH01773

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:17
Well:73
Vector:pOT2
Associated Gene/TranscriptTsp42Ej-RA
Protein status:GH01773.pep: gold
Preliminary Size:1097
Sequenced Size:1041

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12143 2001-01-01 Release 2 assignment
CG12143 2001-09-19 Blastp of sequenced clone
CG12143 2003-01-01 Sim4 clustering to Release 3
Tsp42Ej 2008-04-29 Release 5.5 accounting
Tsp42Ej 2008-08-15 Release 5.9 accounting
Tsp42Ej 2008-12-18 5.12 accounting

Clone Sequence Records

GH01773.complete Sequence

1041 bp (1041 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058262

> GH01773.complete
GCAGCTTTTGTGGCATCAACACCACGAGTTCCAATCCGAAATAGGGCTCA
GAGCTCCGAGCCCAGTTTAATGTGGGTGTAGACCTACTCTGGGCGCAAGT
AAACAATGCCCTGCCCTAAGCCAGTGGCATAGTGCGAATCGAGCGAGTTT
CCGGAACTCGGAGGTCATATCTTCCATTCTATCGGCAGCCAGATACTTTG
GTTCACAAGCATAACTGCCAAGGAAACTCACGTGCGACATTGTGGCAACA
TGGAGAAGTCGTTTCCCATAACACCCTGGAAGTACGGCCTACTGGTCACC
TGCATTCTCATTGTGACGTGCAACGTGTTCTTCTTCTCCTGTGGCGTGAC
CACCTGGGGTTCGGCCGTCTCCGTCTACGGCAGCTATGGGTCGGCACTTT
GCGGAGGAGCAGTTTTCGGAGTCGCCTTCCTGGGCATGTACGTGGCCTTG
AAGGTGTCGTACAAGTATTCCATATACTACCTAATTTGCAGTGGCCTGGT
TATAGCCGCCCTGGGCTCCTACCTCTTCACCTTCACGGCGATGCGGGAGC
AGCTGATGGGCAGGTTCGAGGAGCGCATGCGCGACCTCTTCGAGCGAAAG
ACCCACAGCGACGACAAGATGCAGCCAGTGCACAGCCTCTTCGGCTGCTG
CGGCATTGAGGGACCGCAGGACTACCTTCAGGAGGAGCACGGCGCCCTGC
CCAGCAGCTGCTGCTACGCCTTCGACTGCTCCAAGCCGGCGCACGTCTAC
GAGGAGGGATGCTCCACCAAGGCGGTAGCTACTCTGAGAATGCAGGCGGA
GCTCAACTACTACAGCTGCATGGCGATCATTGCCCTCGAGTTTTTGGGCT
TGTTCACCGCTTACCATTTGGGCAAGGCTCGCAAGTATGCCAAAACCAAG
ATAAAGGACGAGGAGACCCCCATCAACGACTGATGGCCGAGGATACCCCT
GCATGATTATTGATAATAAAAATTAACCAAATTAGCTAAAATGCCATTAG
AAAATAAATACTTTCCATAGCCTAAAAAAAAAAAAAAAAAA

GH01773.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Ej-RA 1276 Tsp42Ej-RA 153..1178 1..1026 5130 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2929197..2929559 478..840 1800 99.7 Plus
chr2R 21145070 chr2R 2927641..2927955 1..315 1575 100 Plus
chr2R 21145070 chr2R 2929983..2930167 839..1023 925 100 Plus
chr2R 21145070 chr2R 2928980..2929142 315..477 815 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:26:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7041785..7042147 478..840 1815 100 Plus
2R 25286936 2R 7040229..7040543 1..315 1575 100 Plus
2R 25286936 2R 7042578..7042765 839..1026 940 100 Plus
2R 25286936 2R 7041568..7041730 315..477 815 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7042984..7043346 478..840 1815 100 Plus
2R 25260384 2R 7041428..7041742 1..315 1575 100 Plus
2R 25260384 2R 7043777..7043964 839..1026 940 100 Plus
2R 25260384 2R 7042767..7042929 315..477 815 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:40:28 has no hits.

GH01773.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:41:25 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2927641..2927955 1..315 100 -> Plus
chr2R 2928981..2929142 316..477 100 -> Plus
chr2R 2929197..2929559 478..840 99 -> Plus
chr2R 2929985..2930167 841..1023 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:04:58 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ej-RA 1..684 250..933 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:57:05 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ej-RA 1..684 250..933 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:55:36 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ej-RA 1..684 250..933 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:26:17 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ej-RA 1..684 250..933 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:00:26 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ej-RA 1..684 250..933 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:43:15 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ej-RA 91..1113 1..1023 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:57:05 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ej-RA 91..1113 1..1023 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:55:36 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ej-RA 94..1116 1..1023 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:26:17 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ej-RA 91..1113 1..1023 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:00:26 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Ej-RA 94..1116 1..1023 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:41:25 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7041569..7041730 316..477 100 -> Plus
2R 7040229..7040543 1..315 100 -> Plus
2R 7041785..7042147 478..840 100 -> Plus
2R 7042580..7042762 841..1023 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:41:25 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7041569..7041730 316..477 100 -> Plus
2R 7040229..7040543 1..315 100 -> Plus
2R 7041785..7042147 478..840 100 -> Plus
2R 7042580..7042762 841..1023 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:41:25 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7041569..7041730 316..477 100 -> Plus
2R 7040229..7040543 1..315 100 -> Plus
2R 7041785..7042147 478..840 100 -> Plus
2R 7042580..7042762 841..1023 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:55:36 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2927734..2928048 1..315 100 -> Plus
arm_2R 2929074..2929235 316..477 100 -> Plus
arm_2R 2929290..2929652 478..840 100 -> Plus
arm_2R 2930085..2930267 841..1023 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:03:28 Download gff for GH01773.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7041428..7041742 1..315 100 -> Plus
2R 7042768..7042929 316..477 100 -> Plus
2R 7042984..7043346 478..840 100 -> Plus
2R 7043779..7043961 841..1023 100   Plus

GH01773.pep Sequence

Translation from 249 to 932

> GH01773.pep
MEKSFPITPWKYGLLVTCILIVTCNVFFFSCGVTTWGSAVSVYGSYGSAL
CGGAVFGVAFLGMYVALKVSYKYSIYYLICSGLVIAALGSYLFTFTAMRE
QLMGRFEERMRDLFERKTHSDDKMQPVHSLFGCCGIEGPQDYLQEEHGAL
PSSCCYAFDCSKPAHVYEEGCSTKAVATLRMQAELNYYSCMAIIALEFLG
LFTAYHLGKARKYAKTKIKDEETPIND*

GH01773.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12687-PA 227 GF12687-PA 1..227 1..227 1035 81.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23248-PA 227 GG23248-PA 1..226 1..226 1185 98.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21505-PA 226 GH21505-PA 1..225 1..227 812 63.9 Plus
Dgri\GH21507-PA 217 GH21507-PA 9..185 11..188 165 25 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Ej-PA 227 CG12143-PA 1..227 1..227 1217 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19474-PA 227 GI19474-PA 1..226 1..227 733 58.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11144-PA 227 GL11144-PA 1..227 1..227 882 67.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11435-PA 227 GA11435-PA 1..227 1..227 882 67.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20922-PA 227 GM20922-PA 1..227 1..227 1198 98.7 Plus
Dsec\GM13129-PA 113 GM13129-PA 1..109 89..197 541 91.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10450-PA 227 GD10450-PA 1..227 1..227 1196 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15135-PA 226 GJ15135-PA 1..225 1..227 778 61.7 Plus
Dvir\GJ15134-PA 226 GJ15134-PA 41..203 45..200 141 25.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21781-PA 232 GK21781-PA 1..230 1..227 853 66.1 Plus
Dwil\GK21783-PA 217 GK21783-PA 9..215 11..213 146 23.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19099-PA 227 GE19099-PA 1..227 1..227 1193 98.7 Plus

GH01773.hyp Sequence

Translation from 249 to 932

> GH01773.hyp
MEKSFPITPWKYGLLVTCILIVTCNVFFFSCGVTTWGSAVSVYGSYGSAL
CGGAVFGVAFLGMYVALKVSYKYSIYYLICSGLVIAALGSYLFTFTAMRE
QLMGRFEERMRDLFERKTHSDDKMQPVHSLFGCCGIEGPQDYLQEEHGAL
PSSCCYAFDCSKPAHVYEEGCSTKAVATLRMQAELNYYSCMAIIALEFLG
LFTAYHLGKARKYAKTKIKDEETPIND*

GH01773.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Ej-PA 227 CG12143-PA 1..227 1..227 1217 100 Plus