Clone GH01922 Report

Search the DGRC for GH01922

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:19
Well:22
Vector:pOT2
Associated Gene/TranscriptTrax-RA
Protein status:GH01922.pep: gold
Preliminary Size:1029
Sequenced Size:1099

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5063 2001-01-01 Release 2 assignment
CG5063 2001-07-04 Blastp of sequenced clone
Trax 2008-04-29 Release 5.5 accounting
Trax 2008-08-15 Release 5.9 accounting
Trax 2008-12-18 5.12 accounting

Clone Sequence Records

GH01922.complete Sequence

1099 bp (1099 high quality bases) assembled on 2001-07-04

GenBank Submission: AY047514

> GH01922.complete
AAAATCTAAAAAAATAAAAACAAAAAAAAAAAACATATTTAAGCCGTTCA
AATAGAATCGCGTAAGATATCAATAATGCCGAAAAACGGAGGTGCTGGTC
ACAGGAACACTGCTCCCAGGAAGCGCCAAATACCGGCTGCCCAGCTGGAT
GAAGACAGTCCCATTGTCCAACAATTTCGAATTTATTCTAATGAATTGAT
CATGAAACACGATCGCCACGAGCGAATTGTCAAGCTGAGCCGTGACATTA
CCATCGAGTCCAAGCGTATCATCTTCCTGCTGCACTCCATTGACTCGCGT
AAGCAGAATAAGGAGAAGGTCCTGGAGGAGGCACGTCAGCGACTGAACAA
GCTGATCGCGGTTAACTTTAGGGCTGTGGCCCTGGAACTGCGCGACCAGG
ATGTCTACCAGTTCCGCAGCTCCTACTCTCCAGGATTGCAGGAGTTTATC
GAGGCCTACACCTACATGGAGTACCTGTGCCACGAGGATGCTGAGGGCGA
GAACGAAACCAAGAGCGTTTCAGATTGGCAGGCCATTCAGGCGGTGATGC
AGTACGTCGAGGAGAGCAGCCAGCCAAAGGAAGAACCAACTGAAGGCGAA
GATGTTCAGGCTATAGCTCAGGTTGAGAGCCCAAAGAAGTTCCAGTTTTT
CGTAGACCCCACGGAATATATACTTGGACTTTCGGATCTTACTGGTGAAC
TGATGCGCCGCTGCATAAATTCGCTAGGCAGTGGAGATACAGACACCTGT
TTGGACACCTGCAAGGCCCTGCAGCATTTCTACAGCGGGTTGGTTAGTTC
TCCCTTAAGAAACTCAATTAACTTCCTATTGTTTTCAGTTACATCAGTCT
AAACTGTCAGAGAGCCCGTGAACTATGGCGTAAGATCACTACCATGAAGC
AGAGCGTTCTTAAGGCCGAGAATGTTTGCTACAATGTAAAAGTTCGCGGC
GGAGAGGCTGCAAAATGGGGCGCCACTTTTGATCAAAAGCCAGCCGATGA
AGTTGACGAGGGCTTCTACTAATGGAACTCCATAGACATAAGTTTTCATC
AACAGAATATAATATATATATATAAAGCCTAAAAAAAAAAAAAAAAAAA

GH01922.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
Trax-RA 1128 Trax-RA 28..1107 1..1081 5365 99.9 Plus
Trax-RB 1121 Trax-RB 41..827 1..788 3900 99.8 Plus
Trax-RB 1121 Trax-RB 827..1070 838..1081 1220 100 Plus
CG6171-RB 1025 CG6171-RB 987..1025 1081..1043 195 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11186386..11187464 1..1080 5350 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:27:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15361751..15362830 1..1081 5355 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:59:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15102582..15103661 1..1081 5365 99.9 Plus
Blast to na_te.dros performed on 2019-03-15 15:29:53 has no hits.

GH01922.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:30:45 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11186428..11187438 44..1054 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:05:52 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
Trax-RA 1..777 76..852 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:28:51 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
Trax-RA 1..777 76..852 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:30:27 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
Trax-RA 1..777 76..852 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:02:14 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
Trax-RA 1..777 76..852 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:08:07 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
Trax-RA 1..777 76..852 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:29:03 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
Trax-RA 28..1106 1..1080 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:28:51 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
Trax-RA 28..1106 1..1080 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:30:27 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
Trax-RA 60..1127 1..1069 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:02:14 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
Trax-RA 28..1106 1..1080 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:08:07 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
Trax-RA 60..1127 1..1069 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:45 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15361751..15362829 1..1080 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:45 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15361751..15362829 1..1080 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:45 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15361751..15362829 1..1080 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:30:27 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11187473..11188551 1..1080 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:40:12 Download gff for GH01922.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15102582..15103660 1..1080 99   Plus

GH01922.hyp Sequence

Translation from 75 to 851

> GH01922.hyp
MPKNGGAGHRNTAPRKRQIPAAQLDEDSPIVQQFRIYSNELIMKHDRHER
IVKLSRDITIESKRIIFLLHSIDSRKQNKEKVLEEARQRLNKLIAVNFRA
VALELRDQDVYQFRSSYSPGLQEFIEAYTYMEYLCHEDAEGENETKSVSD
WQAIQAVMQYVEESSQPKEEPTEGEDVQAIAQVESPKKFQFFVDPTEYIL
GLSDLTGELMRRCINSLGSGDTDTCLDTCKALQHFYSGLVSSPLRNSINF
LLFSVTSV*

GH01922.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
Trax-PA 258 CG5063-PA 1..258 1..258 1322 100 Plus
Trax-PB 298 CG5063-PB 1..241 1..241 1235 99.2 Plus

GH01922.pep Sequence

Translation from 75 to 851

> GH01922.pep
MPKNGGAGHRNTAPRKRQIPAAQLDEDSPIVQQFRIYSNELIMKHDRHER
IVKLSRDITIESKRIIFLLHSIDSRKQNKEKVLEEARQRLNKLIAVNFRA
VALELRDQDVYQFRSSYSPGLQEFIEAYTYMEYLCHEDAEGENETKSVSD
WQAIQAVMQYVEESSQPKEEPTEGEDVQAIAQVESPKKFQFFVDPTEYIL
GLSDLTGELMRRCINSLGSGDTDTCLDTCKALQHFYSGLVSSPLRNSINF
LLFSVTSV*

GH01922.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18294-PA 297 GF18294-PA 1..240 1..241 967 76.7 Plus
Dana\GF20675-PA 99 GF20675-PA 1..82 158..237 302 75 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16922-PA 298 GG16922-PA 1..241 1..241 1223 93.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16640-PA 296 GH16640-PA 1..240 1..241 883 71.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Trax-PC 298 CG5063-PC 1..241 1..241 1235 99.2 Plus
Trax-PB 298 CG5063-PB 1..241 1..241 1235 99.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22036-PA 294 GI22036-PA 1..238 1..241 900 72.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13728-PA 299 GL13728-PA 1..248 1..247 885 68.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18631-PA 299 GA18631-PA 1..248 1..247 885 68.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24228-PA 298 GM24228-PA 1..241 1..241 1260 96.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:20:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19019-PA 298 GD19019-PA 1..241 1..241 1270 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:20:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10483-PA 292 GJ10483-PA 1..236 1..241 879 70.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:20:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11778-PA 289 GK11778-PA 1..232 1..241 902 72.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24305-PA 298 GE24305-PA 1..241 1..241 1199 91.3 Plus