Clone GH01933 Report

Search the DGRC for GH01933

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:19
Well:33
Vector:pOT2
Associated Gene/TranscriptCG3955-RA
Protein status:GH01933.pep: gold
Preliminary Size:1198
Sequenced Size:1018

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3955 2001-01-01 Release 2 assignment
CG3955 2001-10-10 Blastp of sequenced clone
CG3955 2003-01-01 Sim4 clustering to Release 3
CG3955 2008-04-29 Release 5.5 accounting
CG3955 2008-08-15 Release 5.9 accounting
CG3955 2008-12-18 5.12 accounting

Clone Sequence Records

GH01933.complete Sequence

1018 bp (1018 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060602

> GH01933.complete
TCAGATGGAGAGCAGTGGGGTTCACGGAATGAGGAGCACGTAAACAAGAG
AACCTCGGGCCACTTTAGATTAGCCAAGGGATTGGGTGGCCAGCAGCAGG
ATGATCCGGCCCTTCGTCACGTTGCTCTACTTCCTGCTGACCAGTTCGTC
CATCGTGTTCACAGCCTGTGTGAATAATGTGACAGGCACCAGTTCACCCG
GACCCGGACCCAGTACCTCGCTGACCAGCGGGCACATTCACCGCACGGCG
GCAGCCATCGAAAGGGTGAACAAACTGTGGTGCTTTGCCTGCCACACGAT
GGATGATGGGGAGGCCTGCGTGGATGTGGCGGTCCGGAACGATTCCGCAC
TGATGAAAAAGTGCCAGGGCGAGGAGTTCATCTGCATGGTCAAGCGGTTC
TCGTACACCACCAGCACGGAGAACTCCACCAGTTCGCCCAAGATGTGGTC
CCTGGACCGGCGATGTACTGCCAACTGTGAGCCCGGCTGCATCATCATTG
GCGAGCGGACCAAGCTCTATTCCTGCACTTCCTGCTGCGAGGAGTCCTTT
TGTAATACGGGTCGAGGAGCTGCATCCGGGATCTTCCATCGCGAGGACAC
GGGCATCGGCACACGGCTGTTTTGGCTGGCCGCCCCCTTTCTGGTCAACA
TGTCGCTGGTCCTGTACAAACGGCACGCCGGCCACGTTCTCCTCAAGCTG
CAATAGGCCTTCGGGTCACCTCACAGAATTTACGGACACTCAGCGCTCTC
AAAGATGCTCCACACTGAACTCAACTCCACTAAATGCCAAATCCTAGCTA
ACTTTAGTTCGATCTCTTCTGCAATGTAGATAGGCCATCATGTTGCCGGG
TGATAAGAAGAGCCACAGCGAGTTCACACCCAACAAAACGGAAAATCCTC
AATTGGACCCTTGTTTCTGTAGGCTAGTACTAATATTATATTTTACCATG
GATTACTTTTAATTAAAAATAGATTTCCCAGATAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAA

GH01933.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:04:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG3955-RA 1258 CG3955-RA 110..1093 1..984 4920 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9015251..9015846 983..388 2980 100 Minus
chr2R 21145070 chr2R 9015913..9016124 390..179 1060 100 Minus
chr2R 21145070 chr2R 9016196..9016372 179..3 885 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:27:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13127914..13128510 984..388 2985 100 Minus
2R 25286936 2R 13128577..13128788 390..179 1060 100 Minus
2R 25286936 2R 13128860..13129038 179..1 895 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13129113..13129709 984..388 2985 100 Minus
2R 25260384 2R 13129776..13129987 390..179 1060 100 Minus
2R 25260384 2R 13130059..13130237 179..1 895 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:40:31 has no hits.

GH01933.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:41:27 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9015251..9015845 389..983 100 <- Minus
chr2R 9015915..9016123 180..388 100 <- Minus
chr2R 9016196..9016374 1..179 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:05:56 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
CG3955-RA 1..606 101..706 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:40:19 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
CG3955-RA 1..606 101..706 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:51:01 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
CG3955-RA 1..606 101..706 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:09:22 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
CG3955-RA 1..606 101..706 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:51:31 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
CG3955-RA 1..606 101..706 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:21:57 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
CG3955-RA 17..999 1..983 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:40:19 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
CG3955-RA 17..999 1..983 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:51:01 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
CG3955-RA 15..997 1..983 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:09:22 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
CG3955-RA 17..999 1..983 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:51:31 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
CG3955-RA 15..997 1..983 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:27 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13127915..13128509 389..983 100 <- Minus
2R 13128579..13128787 180..388 100 <- Minus
2R 13128860..13129038 1..179 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:27 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13127915..13128509 389..983 100 <- Minus
2R 13128579..13128787 180..388 100 <- Minus
2R 13128860..13129038 1..179 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:27 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13127915..13128509 389..983 100 <- Minus
2R 13128579..13128787 180..388 100 <- Minus
2R 13128860..13129038 1..179 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:51:01 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9015420..9016014 389..983 100 <- Minus
arm_2R 9016084..9016292 180..388 100 <- Minus
arm_2R 9016365..9016543 1..179 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:45:25 Download gff for GH01933.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13129114..13129708 389..983 100 <- Minus
2R 13129778..13129986 180..388 100 <- Minus
2R 13130059..13130237 1..179 100   Minus

GH01933.pep Sequence

Translation from 100 to 705

> GH01933.pep
MIRPFVTLLYFLLTSSSIVFTACVNNVTGTSSPGPGPSTSLTSGHIHRTA
AAIERVNKLWCFACHTMDDGEACVDVAVRNDSALMKKCQGEEFICMVKRF
SYTTSTENSTSSPKMWSLDRRCTANCEPGCIIIGERTKLYSCTSCCEESF
CNTGRGAASGIFHREDTGIGTRLFWLAAPFLVNMSLVLYKRHAGHVLLKL
Q*

GH01933.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:38:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11987-PA 201 GF11987-PA 1..201 1..201 975 95.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22529-PA 201 GG22529-PA 1..201 1..201 1073 99.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21594-PA 210 GH21594-PA 1..210 1..201 851 79.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG3955-PA 201 CG3955-PA 1..201 1..201 1080 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19564-PA 212 GI19564-PA 1..212 1..201 769 77.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10587-PA 200 GL10587-PA 1..198 1..199 826 89.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27874-PA 200 GA27874-PA 1..198 1..199 826 89.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20314-PA 201 GM20314-PA 1..201 1..201 1074 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25792-PA 201 GD25792-PA 1..201 1..201 1074 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21140-PA 210 GJ21140-PA 1..210 1..201 842 82.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21636-PA 106 GK21636-PA 1..103 1..96 322 73.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13400-PA 201 GE13400-PA 1..201 1..201 1074 100 Plus

GH01933.hyp Sequence

Translation from 100 to 705

> GH01933.hyp
MIRPFVTLLYFLLTSSSIVFTACVNNVTGTSSPGPGPSTSLTSGHIHRTA
AAIERVNKLWCFACHTMDDGEACVDVAVRNDSALMKKCQGEEFICMVKRF
SYTTSTENSTSSPKMWSLDRRCTANCEPGCIIIGERTKLYSCTSCCEESF
CNTGRGAASGIFHREDTGIGTRLFWLAAPFLVNMSLVLYKRHAGHVLLKL
Q*

GH01933.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG3955-PA 201 CG3955-PA 1..201 1..201 1080 100 Plus