Clone GH02075 Report

Search the DGRC for GH02075

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:20
Well:75
Vector:pOT2
Associated Gene/TranscriptCG2789-RA
Protein status:GH02075.pep: gold
Preliminary Size:941
Sequenced Size:786

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2789 2001-01-01 Release 2 assignment
CG2789 2003-01-01 Sim4 clustering to Release 3
CG2789 2003-03-19 Blastp of sequenced clone
CG2789 2008-04-29 Release 5.5 accounting
CG2789 2008-08-15 Release 5.9 accounting
CG2789 2008-12-18 5.12 accounting

Clone Sequence Records

GH02075.complete Sequence

786 bp (786 high quality bases) assembled on 2003-03-19

GenBank Submission: AY058269

> GH02075.complete
AAATGGCTGATCGTCCGTGTGCTGGAAACATTCTCCGCATCGCCGGGGCC
GTGATTCTGCCCAATCTGGGCGGCATCTATAACGGGCGGCTGACCAGGCA
GCATCTCCAGAGCTGGTACGCCAACCTTAAGTTCCCGTCCTTCAAGCCGC
CCAACTCGGTCTTTGCGCCGATGTGGATCTCCTTGTACGCGGGAATGGGC
TACGGCTCCTACCTGGTGTGGCGTGATGGCGGAGGCTTCGCCGGCGAGGC
GGCCAAACTGCCCCTGATCGCGTACGGCACCCAGCTGGCCTTGAACTGGG
CGTGGACGCCCATTTTCTTCGGGCAGCACAACATCAAGGGCGGCCTTATT
GACATAGTTGCACTCACGGCCGCCGCGTCCGCCTGCGGCGTTCTGTTCTA
CCGAGTGAACAAGACCGCTGGATTGCTCTTCGTACCCTACGTCGCCTGGC
TGGGATTCGCGACGGCTCTGAACTACGCCATCTGGAAGCTGAACCCGGAG
AAGGAGCAGGCGCCCAAGGACGAGGAGAAGCCCTCTAGCAGCCACGCTAA
GTCGAGTTAAGCCCAGGATAAACGAAAAACAAGTAATTTTGGGTGTCTTT
CATGCAAATTGCAGGGCTTTCCGACCTATCGAACCAGGGCTGGGCAAAGT
TGGATAAAATATCGATAAGCAGTGCCTCCAATGGGGCGCTAAATTCAAAG
TATCATATGCTGCTGCACGTTCAAAAATTCCCTATGTGTTATGTGTTAAT
AATAAATTAAAGAATCGTAAAAAAAAAAAAAAAAAA

GH02075.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG2789-RA 917 CG2789-RA 122..891 1..770 3850 100 Plus
CG2789.b 823 CG2789.b 87..642 1..556 2780 100 Plus
CG2789.a 818 CG2789.a 87..637 1..551 2755 100 Plus
CG2789.b 823 CG2789.b 642..797 615..770 780 100 Plus
CG2789.a 818 CG2789.a 637..792 615..770 780 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 560092..560518 342..768 2120 99.8 Plus
chr2L 23010047 chr2L 559692..560033 1..342 1665 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:27:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 560097..560525 342..770 2145 100 Plus
2L 23513712 2L 559697..560038 1..342 1710 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 560097..560525 342..770 2145 100 Plus
2L 23513712 2L 559697..560038 1..342 1710 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:51:37 has no hits.

GH02075.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:52:28 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 559692..560032 1..341 99 -> Plus
chr2L 560092..560518 342..768 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:06:39 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
CG2789-RA 1..558 3..560 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:46:34 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
CG2789-RA 1..558 3..560 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:56:18 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
CG2789-RA 1..558 3..560 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:38:01 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
CG2789-RA 1..558 3..560 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:55:48 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
CG2789-RA 1..558 3..560 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:58:03 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
CG2789-RA 87..854 1..768 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:46:34 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
CG2789-RA 87..854 1..768 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:56:18 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
CG2789-RA 86..853 1..768 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:38:01 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
CG2789-RA 87..854 1..768 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:55:48 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
CG2789-RA 86..853 1..768 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:28 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
2L 559697..560037 1..341 100 -> Plus
2L 560097..560523 342..768 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:28 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
2L 559697..560037 1..341 100 -> Plus
2L 560097..560523 342..768 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:28 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
2L 559697..560037 1..341 100 -> Plus
2L 560097..560523 342..768 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:56:18 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 559697..560037 1..341 100 -> Plus
arm_2L 560097..560523 342..768 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:08:13 Download gff for GH02075.complete
Subject Subject Range Query Range Percent Splice Strand
2L 559697..560037 1..341 100 -> Plus
2L 560097..560523 342..768 100   Plus

GH02075.pep Sequence

Translation from 2 to 559

> GH02075.pep
MADRPCAGNILRIAGAVILPNLGGIYNGRLTRQHLQSWYANLKFPSFKPP
NSVFAPMWISLYAGMGYGSYLVWRDGGGFAGEAAKLPLIAYGTQLALNWA
WTPIFFGQHNIKGGLIDIVALTAAASACGVLFYRVNKTAGLLFVPYVAWL
GFATALNYAIWKLNPEKEQAPKDEEKPSSSHAKSS*

GH02075.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15022-PA 187 GF15022-PA 5..184 4..181 767 80.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24727-PA 185 GG24727-PA 1..185 1..185 936 95.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23831-PA 177 GH23831-PA 1..176 1..180 681 75 Plus
Dgri\GH11232-PA 177 GH11232-PA 1..176 1..180 681 75 Plus
Dgri\GH10662-PA 114 GH10662-PA 1..112 1..113 424 75.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
Tspo-PA 185 CG2789-PA 1..185 1..185 993 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21766-PA 180 GI21766-PA 1..180 1..184 708 72.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18884-PA 185 GL18884-PA 1..183 1..183 812 84.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15462-PA 185 GA15462-PA 1..183 1..183 812 84.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16750-PA 185 GM16750-PA 1..185 1..185 964 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23032-PA 185 GD23032-PA 1..185 1..185 969 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17784-PA 180 GJ17784-PA 1..180 1..184 718 73.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24622-PA 186 GK24622-PA 5..186 3..185 732 73.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16902-PA 185 GE16902-PA 1..185 1..185 951 97.3 Plus

GH02075.hyp Sequence

Translation from 2 to 559

> GH02075.hyp
MADRPCAGNILRIAGAVILPNLGGIYNGRLTRQHLQSWYANLKFPSFKPP
NSVFAPMWISLYAGMGYGSYLVWRDGGGFAGEAAKLPLIAYGTQLALNWA
WTPIFFGQHNIKGGLIDIVALTAAASACGVLFYRVNKTAGLLFVPYVAWL
GFATALNYAIWKLNPEKEQAPKDEEKPSSSHAKSS*

GH02075.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG2789-PA 185 CG2789-PA 1..185 1..185 993 100 Plus