Clone GH02096 Report

Search the DGRC for GH02096

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:20
Well:96
Vector:pOT2
Associated Gene/Transcriptmaf-S-RA
Protein status:GH02096.pep: gold
Preliminary Size:641
Sequenced Size:704

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9954 2002-01-01 Sim4 clustering to Release 2
CG9954 2003-01-01 Sim4 clustering to Release 3
maf-S 2008-04-29 Release 5.5 accounting
maf-S 2008-08-15 Release 5.9 accounting
maf-S 2008-12-18 5.12 accounting

Clone Sequence Records

GH02096.complete Sequence

704 bp assembled on 2006-11-09

GenBank Submission: BT023717

> GH02096.complete
GCAACCAGCAGGTAGAGAGGAAGAAGAAGACACACAATAACAACGCAAAA
AAAAAAGGTAGAAAAATCTAGCAAATTCTAAAAGTCTCCGTAAAAATAAA
ATACAATCGGCCACAATGGAAGCAAAGCGCGAGAGAAAGTCATCCCTGGC
ACCACTTTCGCCATGTCCAATTCCGGATATTACCGATGACGATTTGGTGA
GCATTTCGGTAAGGGATCTTAATCGGACCCTCAAGATGCGTGGCCTGAAC
CGCGAGGAGATCGTTCGGATGAAGCAGCGCCGGAGAACCTTAAAGAATCG
CGGATACGCAGCCAGTTGCCGCATCAAGAGAATCGAACAGAAGGACGAGC
TGGAGACTAAGAAGTCGTACGAGTGGACGGAACTGGAGCAGATGCACGAG
GACAACGAGCAGGTGCGCCGCGAGGTGTCCAACTGGAAGAACAAGTACAA
GGCGCTGCTGCAGTTCGCCATCCAGAACGAGATACCCATTCCCAGCGAGC
TGGAGGGCTGCTGAACGATTGCCCAGTCACATTCCTGTTTCTGTCAAAAT
TACAATAAACCCAAAACGGAAAAAAACACCTGTAACTAAAGTACAATAGC
TGGCAAATATCCTTCCTCAATAAACGTAATCTGCTCAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

GH02096.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
maf-S-RA 705 maf-S-RA 21..658 1..638 3190 100 Plus
maf-S.a 657 maf-S.a 163..653 148..638 2455 100 Plus
maf-S.b 654 maf-S.b 160..650 148..638 2455 100 Plus
maf-S.a 657 maf-S.a 1..148 1..148 740 100 Plus
maf-S.b 654 maf-S.b 1..148 1..148 740 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16527892..16528380 148..636 2400 99.4 Plus
chr2R 21145070 chr2R 16527684..16527831 1..149 650 97.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:27:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20641180..20641670 148..638 2455 100 Plus
2R 25286936 2R 20640971..20641119 1..149 745 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20642379..20642869 148..638 2455 100 Plus
2R 25260384 2R 20642170..20642318 1..149 745 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:37:01 has no hits.

GH02096.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:37:45 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16527684..16527830 1..148 97 -> Plus
chr2R 16527893..16528380 149..636 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:06:45 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
maf-S-RA 1..399 116..514 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:20:40 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
maf-S-RA 1..399 116..514 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:36:48 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
maf-S-RA 1..399 116..514 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:37:44 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
maf-S-RA 1..399 116..514 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:46:22 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
maf-S-RA 1..399 116..514 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:49:13 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
maf-S-RA 1..636 1..636 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:20:40 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
maf-S-RA 1..636 1..636 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:36:48 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
maf-S-RA 1..631 6..636 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:37:45 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
maf-S-RA 1..636 1..636 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:46:22 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
maf-S-RA 1..631 6..636 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:45 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20640971..20641118 1..148 100 -> Plus
2R 20641181..20641668 149..636 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:45 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20640971..20641118 1..148 100 -> Plus
2R 20641181..20641668 149..636 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:37:45 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20640971..20641118 1..148 100 -> Plus
2R 20641181..20641668 149..636 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:36:48 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16528476..16528623 1..148 100 -> Plus
arm_2R 16528686..16529173 149..636 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:38 Download gff for GH02096.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20642170..20642317 1..148 100 -> Plus
2R 20642380..20642867 149..636 100   Plus

GH02096.hyp Sequence

Translation from 115 to 513

> GH02096.hyp
MEAKRERKSSLAPLSPCPIPDITDDDLVSISVRDLNRTLKMRGLNREEIV
RMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYEWTELEQMHEDNEQV
RREVSNWKNKYKALLQFAIQNEIPIPSELEGC*

GH02096.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
maf-S-PA 132 CG9954-PA 1..132 1..132 682 100 Plus
maf-S-PB 137 CG9954-PB 1..137 1..132 666 96.4 Plus
tj-PB 511 CG10034-PB 389..482 10..116 177 40.2 Plus
tj-PC 555 CG10034-PC 389..482 10..116 177 40.2 Plus

GH02096.pep Sequence

Translation from 115 to 513

> GH02096.pep
MEAKRERKSSLAPLSPCPIPDITDDDLVSISVRDLNRTLKMRGLNREEIV
RMKQRRRTLKNRGYAASCRIKRIEQKDELETKKSYEWTELEQMHEDNEQV
RREVSNWKNKYKALLQFAIQNEIPIPSELEGC*

GH02096.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12187-PA 132 GF12187-PA 1..132 1..132 677 96.2 Plus
Dana\GF14237-PA 524 GF14237-PA 412..497 22..116 182 43.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22047-PA 132 GG22047-PA 1..132 1..132 686 99.2 Plus
Dere\GG21184-PA 507 GG21184-PA 395..451 22..80 177 55.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21986-PA 132 GH21986-PA 1..132 1..132 653 92.4 Plus
Dgri\GH11103-PA 524 GH11103-PA 414..499 22..116 174 41.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
maf-S-PA 132 CG9954-PA 1..132 1..132 682 100 Plus
maf-S-PB 137 CG9954-PB 1..137 1..132 666 96.4 Plus
tj-PB 511 CG10034-PB 389..482 10..116 177 40.2 Plus
tj-PC 555 CG10034-PC 389..482 10..116 177 40.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19689-PA 132 GI19689-PA 1..132 1..132 659 93.9 Plus
Dmoj\GI18225-PA 509 GI18225-PA 399..484 22..116 177 42.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17038-PA 132 GL17038-PA 1..132 1..132 602 87.9 Plus
Dper\GL21212-PA 497 GL21212-PA 385..470 22..116 186 43.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22151-PA 132 GA22151-PA 1..132 1..132 602 87.9 Plus
Dpse\GA10021-PA 497 GA10021-PA 385..470 22..116 186 43.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22031-PA 132 GM22031-PA 1..132 1..132 689 100 Plus
Dsec\GM17351-PA 506 GM17351-PA 393..449 22..80 177 55.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11528-PA 132 GD11528-PA 1..132 1..132 689 100 Plus
Dsim\GD11529-PA 92 GD11529-PA 1..92 41..132 481 100 Plus
Dsim\GD12036-PA 132 GD12036-PA 11..75 10..80 171 52.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17266-PA 132 GJ17266-PA 1..132 1..132 656 93.2 Plus
Dvir\GJ18132-PA 494 GJ18132-PA 386..470 22..115 177 42.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21710-PA 132 GK21710-PA 1..132 1..132 669 94.7 Plus
Dwil\GK24800-PA 516 GK24800-PA 400..485 22..116 183 43.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\maf-S-PA 132 GE12128-PA 1..132 1..132 689 100 Plus
Dyak\GE13257-PA 507 GE13257-PA 393..449 22..80 177 55.9 Plus