Clone GH02250 Report

Search the DGRC for GH02250

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:22
Well:50
Vector:pOT2
Associated Gene/Transcriptocn-RA
Protein status:GH02250.pep: gold
Preliminary Size:609
Sequenced Size:625

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7929 2000-02-14 Blastp of sequenced clone
CG7929 2001-01-01 Release 2 assignment
CG7929 2003-01-01 Sim4 clustering to Release 3
ocn 2008-04-29 Release 5.5 accounting
ocn 2008-08-15 Release 5.9 accounting
ocn 2008-12-18 5.12 accounting

Clone Sequence Records

GH02250.complete Sequence

625 bp (625 high quality bases) assembled on 2000-02-14

GenBank Submission: AF145597

> GH02250.complete
CTACCGTTCATACCAGTTTCTTTTCGGAATATTTCATCTAAATTCCAGTG
CGTTTTCCTAAAATTTTTCCAAAATGAAAACCTTGAATCTTTTGGCACCT
GTTTCACAATTGTTGAAGCCCCTTCGAAGGCAAAGTTCTTCGCGCGTAAA
CGCCCTTTTGATAAATGTTCCTAGAGTTCAGCTTTCTAAAGGCAAGAACA
AGTACCTTTTGATGATGATTCACATGCACGGTTTAACTAGGTTCGGCAGG
ACCATTGTAAGAGGATCCGCCTCCAAGGACCACGAGGAAATCTTTGAGGA
AATCCAAAAGGAGATGGACAAAATTGGAATTTGCGCCAAATGCCTGGGTG
GAGGGTTCATCAGCAACAAGGAGGACAAGAAAGTAATGAAAATTTACGGG
TGCTGCAAGACTTTTGGGGAGGCGCCGCACGGCAGGACGAAGGACATACT
GCTGTCTTGGACCAAATTCCAGCATTACAACATCATCTTGCCCAAAAAGA
ATCTGAACGCGTATCAGTGAAGGCGTTTGAAAGCTTGTTTTATTTTTCCT
AACTGCCCTGTTGGCAATTTATAATACAACAAAAAATTAGTAAATACATG
GCTACATAAAAAAAAAAAAAAAAAA

GH02250.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
ocn-RA 782 ocn-RA 156..763 1..608 3040 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:27:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25859850..25860133 284..1 1420 100 Minus
chr3R 27901430 chr3R 25859418..25859617 607..408 1000 100 Minus
chr3R 27901430 chr3R 25859671..25859796 409..284 630 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:27:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30037435..30037718 284..1 1420 100 Minus
3R 32079331 3R 30037002..30037202 608..408 1005 100 Minus
3R 32079331 3R 30037256..30037381 409..284 630 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29778266..29778549 284..1 1420 100 Minus
3R 31820162 3R 29777833..29778033 608..408 1005 100 Minus
3R 31820162 3R 29778087..29778212 409..284 630 100 Minus
Blast to na_te.dros performed on 2019-03-15 12:27:14 has no hits.

GH02250.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:27:54 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25859418..25859615 410..607 100 <- Minus
chr3R 25859671..25859795 285..409 100 <- Minus
chr3R 25859850..25860133 1..284 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:07:00 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
ocn-RA 1..447 74..520 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:33:22 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
ocn-RA 1..447 74..520 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:43:27 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
ocn-RA 1..447 74..520 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:07:52 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
ocn-RA 1..447 74..520 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:00:22 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
ocn-RA 1..447 74..520 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:35:31 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
ocn-RA 13..619 1..607 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:33:22 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
ocn-RA 13..619 1..607 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:43:27 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
ocn-RA 13..619 1..607 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:07:52 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
ocn-RA 13..619 1..607 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:00:22 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
ocn-RA 13..619 1..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:27:54 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30037003..30037200 410..607 100 <- Minus
3R 30037256..30037380 285..409 100 <- Minus
3R 30037435..30037718 1..284 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:27:54 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30037003..30037200 410..607 100 <- Minus
3R 30037256..30037380 285..409 100 <- Minus
3R 30037435..30037718 1..284 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:27:54 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30037003..30037200 410..607 100 <- Minus
3R 30037256..30037380 285..409 100 <- Minus
3R 30037435..30037718 1..284 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:43:27 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25862725..25862922 410..607 100 <- Minus
arm_3R 25862978..25863102 285..409 100 <- Minus
arm_3R 25863157..25863440 1..284 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:45:27 Download gff for GH02250.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29778266..29778549 1..284 100   Minus
3R 29777834..29778031 410..607 100 <- Minus
3R 29778087..29778211 285..409 100 <- Minus

GH02250.hyp Sequence

Translation from 73 to 519

> GH02250.hyp
MKTLNLLAPVSQLLKPLRRQSSSRVNALLINVPRVQLSKGKNKYLLMMIH
MHGLTRFGRTIVRGSASKDHEEIFEEIQKEMDKIGICAKCLGGGFISNKE
DKKVMKIYGCCKTFGEAPHGRTKDILLSWTKFQHYNIILPKKNLNAYQ*

GH02250.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
ocn-PA 148 CG7929-PA 1..148 1..148 773 100 Plus
janB-PA 140 CG7931-PA 1..136 1..137 306 43.1 Plus
CG18662-PA 146 CG18662-PA 8..128 7..126 187 28.9 Plus
janA-PB 135 CG7933-PB 1..128 4..137 161 33.8 Plus
janA-PA 119 CG7933-PA 6..112 29..137 158 36.9 Plus

GH02250.pep Sequence

Translation from 73 to 519

> GH02250.pep
MKTLNLLAPVSQLLKPLRRQSSSRVNALLINVPRVQLSKGKNKYLLMMIH
MHGLTRFGRTIVRGSASKDHEEIFEEIQKEMDKIGICAKCLGGGFISNKE
DKKVMKIYGCCKTFGEAPHGRTKDILLSWTKFQHYNIILPKKNLNAYQ*

GH02250.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 15:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23242-PA 145 GF23242-PA 1..142 1..141 518 64.8 Plus
Dana\GF19996-PA 115 GF19996-PA 4..114 29..139 286 47.7 Plus
Dana\GF22681-PA 146 GF22681-PA 30..128 29..126 193 34.3 Plus
Dana\GF23241-PA 126 GF23241-PA 6..122 29..147 152 35.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 15:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\ocn-PA 149 GG11972-PA 1..148 1..148 700 93.9 Plus
Dere\janB-PA 140 GG11971-PA 1..138 1..139 342 46 Plus
Dere\GG25321-PA 146 GG25321-PA 7..128 6..126 181 27 Plus
Dere\janA-PA 119 GG11970-PA 6..112 29..137 152 36.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 15:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18402-PA 144 GH18402-PA 22..129 19..126 282 47.2 Plus
Dgri\GH25086-PA 134 GH25086-PA 16..125 29..137 191 32.7 Plus
Dgri\GH18401-PA 122 GH18401-PA 6..115 29..137 133 33.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
ocn-PA 148 CG7929-PA 1..148 1..148 773 100 Plus
janB-PA 140 CG7931-PA 1..136 1..137 306 43.1 Plus
CG18662-PA 146 CG18662-PA 8..128 7..126 187 28.9 Plus
janA-PB 135 CG7933-PB 1..128 4..137 161 33.8 Plus
janA-PA 119 CG7933-PA 6..112 29..137 158 36.9 Plus
janA-PC 119 CG7933-PC 6..112 29..137 158 36.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 15:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17452-PA 148 GI17452-PA 30..139 29..137 210 35.5 Plus
Dmoj\GI23391-PA 123 GI23391-PA 8..116 31..137 138 35.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 15:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20557-PA 140 GL20557-PA 1..140 1..141 327 43.3 Plus
Dper\GL26233-PA 149 GL26233-PA 4..131 3..126 205 36.7 Plus
Dper\GL13482-PA 124 GL13482-PA 6..117 29..137 143 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 15:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20697-PB 140 GA20697-PB 1..140 1..141 325 43.3 Plus
Dpse\GA15041-PA 149 GA15041-PA 4..131 3..126 211 37.5 Plus
Dpse\janA-PB 149 GA20699-PB 31..142 29..137 145 33.3 Plus
Dpse\janA-PA 124 GA20699-PA 6..117 29..137 143 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 15:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\ocn-PA 148 GM12189-PA 1..148 1..148 780 98.6 Plus
Dsec\janB-PA 140 GM12188-PA 1..138 1..139 333 45.3 Plus
Dsec\GM17315-PA 146 GM17315-PA 7..128 6..126 182 27.9 Plus
Dsec\janA-PA 119 GM12187-PA 6..112 29..137 155 37.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 15:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ocn-PA 148 GD17421-PA 1..148 1..148 780 98.6 Plus
Dsim\janB-PA 138 GD17410-PA 5..136 7..139 321 44.8 Plus
Dsim\GD23579-PA 146 GD23579-PA 7..128 6..126 182 27.9 Plus
Dsim\janA-PA 119 GD17399-PA 6..112 29..137 155 37.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 15:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14340-PA 149 GJ14340-PA 31..140 29..137 217 37.3 Plus
Dvir\GJ10386-PA 122 GJ10386-PA 6..115 29..137 165 41.1 Plus
Dvir\GJ10387-PA 61 GJ10387-PA 1..61 81..141 140 41 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 15:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13426-PA 118 GK13426-PA 6..114 29..137 311 47.7 Plus
Dwil\GK15329-PA 146 GK15329-PA 30..128 29..126 206 37.4 Plus
Dwil\GK13425-PA 124 GK13425-PA 21..117 43..137 147 38.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 15:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\ocn-PA 149 GE23422-PA 1..148 1..148 756 93.9 Plus
Dyak\janB-PA 138 GE23420-PA 5..136 7..139 333 44.4 Plus
Dyak\GE18815-PA 146 GE18815-PA 4..128 10..126 182 28.8 Plus
Dyak\janA-PA 119 GE23419-PA 6..112 29..137 146 36.9 Plus