BDGP Sequence Production Resources |
Search the DGRC for GH02250
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 22 |
Well: | 50 |
Vector: | pOT2 |
Associated Gene/Transcript | ocn-RA |
Protein status: | GH02250.pep: gold |
Preliminary Size: | 609 |
Sequenced Size: | 625 |
Gene | Date | Evidence |
---|---|---|
CG7929 | 2000-02-14 | Blastp of sequenced clone |
CG7929 | 2001-01-01 | Release 2 assignment |
CG7929 | 2003-01-01 | Sim4 clustering to Release 3 |
ocn | 2008-04-29 | Release 5.5 accounting |
ocn | 2008-08-15 | Release 5.9 accounting |
ocn | 2008-12-18 | 5.12 accounting |
625 bp (625 high quality bases) assembled on 2000-02-14
GenBank Submission: AF145597
> GH02250.complete CTACCGTTCATACCAGTTTCTTTTCGGAATATTTCATCTAAATTCCAGTG CGTTTTCCTAAAATTTTTCCAAAATGAAAACCTTGAATCTTTTGGCACCT GTTTCACAATTGTTGAAGCCCCTTCGAAGGCAAAGTTCTTCGCGCGTAAA CGCCCTTTTGATAAATGTTCCTAGAGTTCAGCTTTCTAAAGGCAAGAACA AGTACCTTTTGATGATGATTCACATGCACGGTTTAACTAGGTTCGGCAGG ACCATTGTAAGAGGATCCGCCTCCAAGGACCACGAGGAAATCTTTGAGGA AATCCAAAAGGAGATGGACAAAATTGGAATTTGCGCCAAATGCCTGGGTG GAGGGTTCATCAGCAACAAGGAGGACAAGAAAGTAATGAAAATTTACGGG TGCTGCAAGACTTTTGGGGAGGCGCCGCACGGCAGGACGAAGGACATACT GCTGTCTTGGACCAAATTCCAGCATTACAACATCATCTTGCCCAAAAAGA ATCTGAACGCGTATCAGTGAAGGCGTTTGAAAGCTTGTTTTATTTTTCCT AACTGCCCTGTTGGCAATTTATAATACAACAAAAAATTAGTAAATACATG GCTACATAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ocn-RA | 782 | ocn-RA | 156..763 | 1..608 | 3040 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 25859850..25860133 | 284..1 | 1420 | 100 | Minus |
chr3R | 27901430 | chr3R | 25859418..25859617 | 607..408 | 1000 | 100 | Minus |
chr3R | 27901430 | chr3R | 25859671..25859796 | 409..284 | 630 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 30037435..30037718 | 284..1 | 1420 | 100 | Minus |
3R | 32079331 | 3R | 30037002..30037202 | 608..408 | 1005 | 100 | Minus |
3R | 32079331 | 3R | 30037256..30037381 | 409..284 | 630 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 29778266..29778549 | 284..1 | 1420 | 100 | Minus |
3R | 31820162 | 3R | 29777833..29778033 | 608..408 | 1005 | 100 | Minus |
3R | 31820162 | 3R | 29778087..29778212 | 409..284 | 630 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 25859418..25859615 | 410..607 | 100 | <- | Minus |
chr3R | 25859671..25859795 | 285..409 | 100 | <- | Minus |
chr3R | 25859850..25860133 | 1..284 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ocn-RA | 1..447 | 74..520 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ocn-RA | 1..447 | 74..520 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ocn-RA | 1..447 | 74..520 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ocn-RA | 1..447 | 74..520 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ocn-RA | 1..447 | 74..520 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ocn-RA | 13..619 | 1..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ocn-RA | 13..619 | 1..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ocn-RA | 13..619 | 1..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ocn-RA | 13..619 | 1..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ocn-RA | 13..619 | 1..607 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30037003..30037200 | 410..607 | 100 | <- | Minus |
3R | 30037256..30037380 | 285..409 | 100 | <- | Minus |
3R | 30037435..30037718 | 1..284 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30037003..30037200 | 410..607 | 100 | <- | Minus |
3R | 30037256..30037380 | 285..409 | 100 | <- | Minus |
3R | 30037435..30037718 | 1..284 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30037003..30037200 | 410..607 | 100 | <- | Minus |
3R | 30037256..30037380 | 285..409 | 100 | <- | Minus |
3R | 30037435..30037718 | 1..284 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 25862725..25862922 | 410..607 | 100 | <- | Minus |
arm_3R | 25862978..25863102 | 285..409 | 100 | <- | Minus |
arm_3R | 25863157..25863440 | 1..284 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29778266..29778549 | 1..284 | 100 | Minus | |
3R | 29777834..29778031 | 410..607 | 100 | <- | Minus |
3R | 29778087..29778211 | 285..409 | 100 | <- | Minus |
Translation from 73 to 519
> GH02250.hyp MKTLNLLAPVSQLLKPLRRQSSSRVNALLINVPRVQLSKGKNKYLLMMIH MHGLTRFGRTIVRGSASKDHEEIFEEIQKEMDKIGICAKCLGGGFISNKE DKKVMKIYGCCKTFGEAPHGRTKDILLSWTKFQHYNIILPKKNLNAYQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ocn-PA | 148 | CG7929-PA | 1..148 | 1..148 | 773 | 100 | Plus |
janB-PA | 140 | CG7931-PA | 1..136 | 1..137 | 306 | 43.1 | Plus |
CG18662-PA | 146 | CG18662-PA | 8..128 | 7..126 | 187 | 28.9 | Plus |
janA-PB | 135 | CG7933-PB | 1..128 | 4..137 | 161 | 33.8 | Plus |
janA-PA | 119 | CG7933-PA | 6..112 | 29..137 | 158 | 36.9 | Plus |
Translation from 73 to 519
> GH02250.pep MKTLNLLAPVSQLLKPLRRQSSSRVNALLINVPRVQLSKGKNKYLLMMIH MHGLTRFGRTIVRGSASKDHEEIFEEIQKEMDKIGICAKCLGGGFISNKE DKKVMKIYGCCKTFGEAPHGRTKDILLSWTKFQHYNIILPKKNLNAYQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23242-PA | 145 | GF23242-PA | 1..142 | 1..141 | 518 | 64.8 | Plus |
Dana\GF19996-PA | 115 | GF19996-PA | 4..114 | 29..139 | 286 | 47.7 | Plus |
Dana\GF22681-PA | 146 | GF22681-PA | 30..128 | 29..126 | 193 | 34.3 | Plus |
Dana\GF23241-PA | 126 | GF23241-PA | 6..122 | 29..147 | 152 | 35.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\ocn-PA | 149 | GG11972-PA | 1..148 | 1..148 | 700 | 93.9 | Plus |
Dere\janB-PA | 140 | GG11971-PA | 1..138 | 1..139 | 342 | 46 | Plus |
Dere\GG25321-PA | 146 | GG25321-PA | 7..128 | 6..126 | 181 | 27 | Plus |
Dere\janA-PA | 119 | GG11970-PA | 6..112 | 29..137 | 152 | 36.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18402-PA | 144 | GH18402-PA | 22..129 | 19..126 | 282 | 47.2 | Plus |
Dgri\GH25086-PA | 134 | GH25086-PA | 16..125 | 29..137 | 191 | 32.7 | Plus |
Dgri\GH18401-PA | 122 | GH18401-PA | 6..115 | 29..137 | 133 | 33.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ocn-PA | 148 | CG7929-PA | 1..148 | 1..148 | 773 | 100 | Plus |
janB-PA | 140 | CG7931-PA | 1..136 | 1..137 | 306 | 43.1 | Plus |
CG18662-PA | 146 | CG18662-PA | 8..128 | 7..126 | 187 | 28.9 | Plus |
janA-PB | 135 | CG7933-PB | 1..128 | 4..137 | 161 | 33.8 | Plus |
janA-PA | 119 | CG7933-PA | 6..112 | 29..137 | 158 | 36.9 | Plus |
janA-PC | 119 | CG7933-PC | 6..112 | 29..137 | 158 | 36.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17452-PA | 148 | GI17452-PA | 30..139 | 29..137 | 210 | 35.5 | Plus |
Dmoj\GI23391-PA | 123 | GI23391-PA | 8..116 | 31..137 | 138 | 35.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20557-PA | 140 | GL20557-PA | 1..140 | 1..141 | 327 | 43.3 | Plus |
Dper\GL26233-PA | 149 | GL26233-PA | 4..131 | 3..126 | 205 | 36.7 | Plus |
Dper\GL13482-PA | 124 | GL13482-PA | 6..117 | 29..137 | 143 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20697-PB | 140 | GA20697-PB | 1..140 | 1..141 | 325 | 43.3 | Plus |
Dpse\GA15041-PA | 149 | GA15041-PA | 4..131 | 3..126 | 211 | 37.5 | Plus |
Dpse\janA-PB | 149 | GA20699-PB | 31..142 | 29..137 | 145 | 33.3 | Plus |
Dpse\janA-PA | 124 | GA20699-PA | 6..117 | 29..137 | 143 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\ocn-PA | 148 | GM12189-PA | 1..148 | 1..148 | 780 | 98.6 | Plus |
Dsec\janB-PA | 140 | GM12188-PA | 1..138 | 1..139 | 333 | 45.3 | Plus |
Dsec\GM17315-PA | 146 | GM17315-PA | 7..128 | 6..126 | 182 | 27.9 | Plus |
Dsec\janA-PA | 119 | GM12187-PA | 6..112 | 29..137 | 155 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\ocn-PA | 148 | GD17421-PA | 1..148 | 1..148 | 780 | 98.6 | Plus |
Dsim\janB-PA | 138 | GD17410-PA | 5..136 | 7..139 | 321 | 44.8 | Plus |
Dsim\GD23579-PA | 146 | GD23579-PA | 7..128 | 6..126 | 182 | 27.9 | Plus |
Dsim\janA-PA | 119 | GD17399-PA | 6..112 | 29..137 | 155 | 37.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14340-PA | 149 | GJ14340-PA | 31..140 | 29..137 | 217 | 37.3 | Plus |
Dvir\GJ10386-PA | 122 | GJ10386-PA | 6..115 | 29..137 | 165 | 41.1 | Plus |
Dvir\GJ10387-PA | 61 | GJ10387-PA | 1..61 | 81..141 | 140 | 41 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13426-PA | 118 | GK13426-PA | 6..114 | 29..137 | 311 | 47.7 | Plus |
Dwil\GK15329-PA | 146 | GK15329-PA | 30..128 | 29..126 | 206 | 37.4 | Plus |
Dwil\GK13425-PA | 124 | GK13425-PA | 21..117 | 43..137 | 147 | 38.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\ocn-PA | 149 | GE23422-PA | 1..148 | 1..148 | 756 | 93.9 | Plus |
Dyak\janB-PA | 138 | GE23420-PA | 5..136 | 7..139 | 333 | 44.4 | Plus |
Dyak\GE18815-PA | 146 | GE18815-PA | 4..128 | 10..126 | 182 | 28.8 | Plus |
Dyak\janA-PA | 119 | GE23419-PA | 6..112 | 29..137 | 146 | 36.9 | Plus |