BDGP Sequence Production Resources |
Search the DGRC for GH02317
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 23 |
Well: | 17 |
Vector: | pOT2 |
Associated Gene/Transcript | Ppt2-RA |
Protein status: | GH02317.pep: gold |
Sequenced Size: | 1256 |
Gene | Date | Evidence |
---|---|---|
CG4851 | 2003-01-01 | Sim4 clustering to Release 3 |
CG4851 | 2005-01-26 | Blastp of sequenced clone |
CG4851 | 2008-04-29 | Release 5.5 accounting |
CG4851 | 2008-08-15 | Release 5.9 accounting |
Ppt2 | 2008-12-18 | 5.12 accounting |
1256 bp (1256 high quality bases) assembled on 2005-01-26
GenBank Submission: BT021446
> GH02317.complete AGAGAACTAGTCTCGAGTTTTTTTTTTTTTTTTTTTCCAAAGCGGGTAGC AAGAAGAAGAGCGGCTAATAAAGATACGGATACATCAACAACAACAGTCG GAAATCCATTGTTCCCCACAAAATGAGACTTCGTTTGCAAGTCCTGGTGG CCCTGTTAACCTGCTCGTCCATTTCCGTCTCACTGGCCTACAAACCGGTG GTCATACTCCATGGAATTCTATCAGGAGCCGAATCGATGGCCTCTCTGGT CCGGGAAATCGAAGAGTTTCATCCTGGCACTATCGTCTACAACTGCGACA AGTTCAATGGATGGTACAGCTTGGAGAACGCCTGGCGACAGGTCGATCAG GTTAGGGATTATCTCAACGAGGTGGGCAAACTGCATCCAGAGGGCATCAT TGTGCTGGGATACTCACAAGGAGGCCTTTTGGCCCGGGCGGCCATCCAAA GTCTGCCCGAGCACAATGTGAAGACCTTTATATCTCTATCCTCGCCACAG GCGGGGCAATACGGCACTAGCTTCTTGCATCTAATCTTTCCCGACTTGGC GGCCAAGACAGCCTTCGAATTGTTCTACTCGCGCGTGGGACAGCACACCT CGGTTGGTGGCTACTGGAACGATCCGCAGAGGCAGGATCTCTACCTGAAG TACAGCGAATTCCTGCCACTGATCAATAATGAGAAGAAGACCTCCAACTC CACATCTTTTAAGATGGGAATGGTGCGTCTAAATAAGTTGGTAATGATCG GCGGACCCAACGACGATGTGATTACTCCGTGGCAATCGAGCCACTTTGGT TACTTTGACGAGAATATGGATGTGATTCCATTTATTAGGCGACCGATTTT CACCAGCGACTCCATTGGCATCAGGACGCTTCAGGAGGCCGGCAAGCTTA TCATTGTGGTCAAACCCCATGTTCATCATCTTGCCTGGCACACGCGAAGG GATGTCATCCACGAAGTGATATTTCCATATCTGGACTGAATAAGAAACCA AAACTACTGAACTATACTGAGCGATCAAACGGCTGTGATCGGAAAGGCGG ACAAAGGCTCACTCTCATCAATAAGCATTAATGTGAAGTTGCTGCCTGGG TAATTAGGCTACAAACATGATCTTTTATTGGTAACTAAGCTATATATTTT TAAAACAGCCTGCGTATTGCAGCAGAGATTTTTACAAAAACTCATAAACT ACTTATAAATAGCCAAATAAAGTGAAACTAGAAATTTTTAAAAAAAAAAA AAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ppt2-RA | 1471 | Ppt2-RA | 237..1445 | 34..1242 | 6045 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 11280208..11280658 | 789..1239 | 2255 | 100 | Plus |
chr2L | 23010047 | chr2L | 11279871..11280144 | 517..790 | 1370 | 100 | Plus |
chr2L | 23010047 | chr2L | 11279021..11279253 | 34..266 | 1135 | 99.1 | Plus |
chr2L | 23010047 | chr2L | 11279353..11279497 | 265..409 | 710 | 99.3 | Plus |
chr2L | 23010047 | chr2L | 11279558..11279666 | 408..516 | 545 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 11281470..11281923 | 789..1242 | 2270 | 100 | Plus |
2L | 23513712 | 2L | 11281133..11281406 | 517..790 | 1370 | 100 | Plus |
2L | 23513712 | 2L | 11280283..11280515 | 34..266 | 1165 | 100 | Plus |
2L | 23513712 | 2L | 11280615..11280759 | 265..409 | 725 | 100 | Plus |
2L | 23513712 | 2L | 11280820..11280928 | 408..516 | 545 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 11281470..11281923 | 789..1242 | 2270 | 100 | Plus |
2L | 23513712 | 2L | 11281133..11281406 | 517..790 | 1370 | 100 | Plus |
2L | 23513712 | 2L | 11280283..11280515 | 34..266 | 1165 | 100 | Plus |
2L | 23513712 | 2L | 11280615..11280759 | 265..409 | 725 | 100 | Plus |
2L | 23513712 | 2L | 11280820..11280928 | 408..516 | 545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 11279019..11279253 | 32..266 | 98 | -> | Plus |
chr2L | 11279355..11279496 | 267..408 | 99 | -> | Plus |
chr2L | 11279559..11279666 | 409..516 | 100 | -> | Plus |
chr2L | 11279871..11280144 | 517..790 | 100 | -> | Plus |
chr2L | 11280210..11280658 | 791..1239 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ppt2-RA | 1..867 | 123..989 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ppt2-RA | 1..867 | 123..989 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ppt2-RA | 1..867 | 123..989 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4851-RA | 1..867 | 123..989 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ppt2-RA | 1..867 | 123..989 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ppt2-RA | 1..1175 | 65..1239 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ppt2-RA | 1..1175 | 65..1239 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ppt2-RA | 1..1191 | 49..1239 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4851-RA | 1..1175 | 65..1239 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ppt2-RA | 1..1191 | 49..1239 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11280281..11280515 | 32..266 | 99 | -> | Plus |
2L | 11280617..11280758 | 267..408 | 100 | -> | Plus |
2L | 11280821..11280928 | 409..516 | 100 | -> | Plus |
2L | 11281133..11281406 | 517..790 | 100 | -> | Plus |
2L | 11281472..11281920 | 791..1239 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11280281..11280515 | 32..266 | 99 | -> | Plus |
2L | 11280617..11280758 | 267..408 | 100 | -> | Plus |
2L | 11280821..11280928 | 409..516 | 100 | -> | Plus |
2L | 11281133..11281406 | 517..790 | 100 | -> | Plus |
2L | 11281472..11281920 | 791..1239 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11280281..11280515 | 32..266 | 99 | -> | Plus |
2L | 11280617..11280758 | 267..408 | 100 | -> | Plus |
2L | 11280821..11280928 | 409..516 | 100 | -> | Plus |
2L | 11281133..11281406 | 517..790 | 100 | -> | Plus |
2L | 11281472..11281920 | 791..1239 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 11280281..11280515 | 32..266 | 99 | -> | Plus |
arm_2L | 11280617..11280758 | 267..408 | 100 | -> | Plus |
arm_2L | 11280821..11280928 | 409..516 | 100 | -> | Plus |
arm_2L | 11281133..11281406 | 517..790 | 100 | -> | Plus |
arm_2L | 11281472..11281920 | 791..1239 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11280281..11280515 | 32..266 | 99 | -> | Plus |
2L | 11280617..11280758 | 267..408 | 100 | -> | Plus |
2L | 11280821..11280928 | 409..516 | 100 | -> | Plus |
2L | 11281133..11281406 | 517..790 | 100 | -> | Plus |
2L | 11281472..11281920 | 791..1239 | 100 | Plus |
Translation from 122 to 988
> GH02317.pep MRLRLQVLVALLTCSSISVSLAYKPVVILHGILSGAESMASLVREIEEFH PGTIVYNCDKFNGWYSLENAWRQVDQVRDYLNEVGKLHPEGIIVLGYSQG GLLARAAIQSLPEHNVKTFISLSSPQAGQYGTSFLHLIFPDLAAKTAFEL FYSRVGQHTSVGGYWNDPQRQDLYLKYSEFLPLINNEKKTSNSTSFKMGM VRLNKLVMIGGPNDDVITPWQSSHFGYFDENMDVIPFIRRPIFTSDSIGI RTLQEAGKLIIVVKPHVHHLAWHTRRDVIHEVIFPYLD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14769-PA | 165 | GF14769-PA | 1..152 | 1..152 | 694 | 86.8 | Plus |
Dana\GF14770-PA | 114 | GF14770-PA | 1..114 | 175..288 | 544 | 84.2 | Plus |
Dana\GF19174-PA | 306 | GF19174-PA | 90..281 | 72..262 | 161 | 26.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23717-PA | 288 | GG23717-PA | 1..288 | 1..288 | 1481 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13391-PA | 284 | GH13391-PA | 1..284 | 5..288 | 1179 | 75.4 | Plus |
Dgri\GH24517-PA | 306 | GH24517-PA | 89..277 | 72..259 | 148 | 25.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ppt2-PA | 288 | CG4851-PA | 1..288 | 1..288 | 1511 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20683-PA | 284 | GI20683-PA | 1..284 | 5..288 | 1261 | 79.9 | Plus |
Dmoj\GI15083-PA | 311 | GI15083-PA | 38..282 | 25..259 | 184 | 28.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19554-PA | 282 | GL19554-PA | 1..282 | 3..288 | 1271 | 81.5 | Plus |
Dper\GL13042-PA | 265 | GL13042-PA | 50..238 | 72..259 | 152 | 26.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18478-PA | 282 | GA18478-PA | 1..282 | 3..288 | 1271 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18996-PA | 288 | GM18996-PA | 1..288 | 1..288 | 1510 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23774-PA | 288 | GD23774-PA | 1..288 | 1..288 | 1508 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13278-PA | 284 | GJ13278-PA | 1..284 | 5..288 | 1218 | 77.1 | Plus |
Translation from 122 to 988
> GH02317.hyp MRLRLQVLVALLTCSSISVSLAYKPVVILHGILSGAESMASLVREIEEFH PGTIVYNCDKFNGWYSLENAWRQVDQVRDYLNEVGKLHPEGIIVLGYSQG GLLARAAIQSLPEHNVKTFISLSSPQAGQYGTSFLHLIFPDLAAKTAFEL FYSRVGQHTSVGGYWNDPQRQDLYLKYSEFLPLINNEKKTSNSTSFKMGM VRLNKLVMIGGPNDDVITPWQSSHFGYFDENMDVIPFIRRPIFTSDSIGI RTLQEAGKLIIVVKPHVHHLAWHTRRDVIHEVIFPYLD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ppt2-PA | 288 | CG4851-PA | 1..288 | 1..288 | 1511 | 100 | Plus |