Clone GH02466 Report

Search the DGRC for GH02466

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:24
Well:66
Vector:pOT2
Associated Gene/TranscriptCG7506-RA
Protein status:GH02466.pep: gold
Preliminary Size:918
Sequenced Size:786

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7506 2001-01-01 Release 2 assignment
CG7506 2001-10-10 Blastp of sequenced clone
CG7506 2003-01-01 Sim4 clustering to Release 3
CG7506 2008-04-29 Release 5.5 accounting
CG7506 2008-08-15 Release 5.9 accounting
CG7506 2008-12-18 5.12 accounting

Clone Sequence Records

GH02466.complete Sequence

786 bp (786 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060605

> GH02466.complete
AAACAGCTGTTTATTTCTACTGAAATAAGTAAATTACACCATGTTAGGCC
TGCGAGCGATGCTGCCAAAAGGGAAACACTTTGCTGTTGTCCTGGGAAAT
GTCAGCCGTCAGATTACCCTGCCCCACAACTGCAGATGCATTACTAGTGC
CTCATGGACAAGACCACAGCAGTCACAACCACAGAACTTCCAGCAAAACA
GGTGGCTTTCGGTGAAGTCGACGAAAACTGAATCCGACGATGCACTGCAG
CGGATCTACTATGGAACTCTTGCGCCACGCATGAAAATGGTCAAGTTCTT
TTCGCTGAGCACCAGCTTAGCCGGCTTGGCCGCCCAGCCCATTCTTCTCG
AGCAGGGAATGAAAATCGGAGGAACTGGAATGGCCGTATTCCTCTGCACC
GTCGGTGGATTCTTCACCTTTGTGACTCCTCTGCTGCTGCACTTTATTAC
CAAGAAATACGTGACGGAGCTGCACTACAATCCACTAACGGAGGAGTACA
CGGCCACCACAATATCCCTGCTTCTGCAAAAAATCAAGACTACTTTCCGA
CCAAATGATGTGGTCGTTCCGGAGGTTCCCGGCATGTTCACCTCTTTTCT
GGTCAACAAACGACCTCTGTTTGTGGATCCAGCGCTTTTCGATGATCCCG
AGCACTATGTTAAGATAATGGGTTACGACAAACCGATCGATTTCAAACTG
GATCTGACTCCGAATCCTGAAAAGTCGAAAACGAGCGAGGAGAAGCAATA
AAAAAAACGCTCTTTATGAAAAAAAAAAAAAAAAAA

GH02466.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG7506-RA 1110 CG7506-RA 171..939 1..769 3845 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7633178..7633715 538..1 2570 98.5 Minus
chr3L 24539361 chr3L 7632901..7633121 757..537 1090 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:27:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7641086..7641623 538..1 2690 100 Minus
3L 28110227 3L 7640797..7641029 769..537 1165 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7634186..7634723 538..1 2690 100 Minus
3L 28103327 3L 7633897..7634129 769..537 1165 100 Minus
Blast to na_te.dros performed on 2019-03-16 17:58:31 has no hits.

GH02466.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:59:27 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7632888..7633119 539..768 98 <- Minus
chr3L 7633178..7633715 1..538 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:07:52 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
CG7506-RA 1..711 41..751 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:58 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
CG7506-RA 1..711 41..751 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:05:23 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
CG7506-RA 1..711 41..751 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:26:11 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
CG7506-RA 1..711 41..751 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:24:55 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
CG7506-RA 1..711 41..751 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:43:06 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
CG7506-RA 24..791 1..768 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:57 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
CG7506-RA 24..791 1..768 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:05:23 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
CG7506-RA 26..793 1..768 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:26:11 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
CG7506-RA 24..791 1..768 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:24:55 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
CG7506-RA 26..793 1..768 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:59:27 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7640798..7641027 539..768 100 <- Minus
3L 7641086..7641623 1..538 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:59:27 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7640798..7641027 539..768 100 <- Minus
3L 7641086..7641623 1..538 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:59:27 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7640798..7641027 539..768 100 <- Minus
3L 7641086..7641623 1..538 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:05:23 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7633898..7634127 539..768 100 <- Minus
arm_3L 7634186..7634723 1..538 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:03:19 Download gff for GH02466.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7633898..7634127 539..768 100 <- Minus
3L 7634186..7634723 1..538 100   Minus

GH02466.hyp Sequence

Translation from 40 to 750

> GH02466.hyp
MLGLRAMLPKGKHFAVVLGNVSRQITLPHNCRCITSASWTRPQQSQPQNF
QQNRWLSVKSTKTESDDALQRIYYGTLAPRMKMVKFFSLSTSLAGLAAQP
ILLEQGMKIGGTGMAVFLCTVGGFFTFVTPLLLHFITKKYVTELHYNPLT
EEYTATTISLLLQKIKTTFRPNDVVVPEVPGMFTSFLVNKRPLFVDPALF
DDPEHYVKIMGYDKPIDFKLDLTPNPEKSKTSEEKQ*

GH02466.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG7506-PA 236 CG7506-PA 1..236 1..236 1234 100 Plus

GH02466.pep Sequence

Translation from 40 to 750

> GH02466.pep
MLGLRAMLPKGKHFAVVLGNVSRQITLPHNCRCITSASWTRPQQSQPQNF
QQNRWLSVKSTKTESDDALQRIYYGTLAPRMKMVKFFSLSTSLAGLAAQP
ILLEQGMKIGGTGMAVFLCTVGGFFTFVTPLLLHFITKKYVTELHYNPLT
EEYTATTISLLLQKIKTTFRPNDVVVPEVPGMFTSFLVNKRPLFVDPALF
DDPEHYVKIMGYDKPIDFKLDLTPNPEKSKTSEEKQ*

GH02466.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23773-PA 236 GF23773-PA 1..236 1..236 896 73.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14946-PA 236 GG14946-PA 1..236 1..236 1165 92.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16859-PA 241 GH16859-PA 1..241 1..234 793 63.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG7506-PA 236 CG7506-PA 1..236 1..236 1234 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13082-PA 242 GI13082-PA 1..232 1..228 742 64.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24121-PA 238 GL24121-PA 1..238 1..235 910 73.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20399-PA 238 GA20399-PA 1..238 1..235 906 72.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13741-PA 236 GM13741-PA 1..236 1..236 1126 94.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13042-PA 236 GD13042-PA 1..236 1..236 1135 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13831-PA 234 GJ13831-PA 1..233 1..230 828 68.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:17:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24268-PA 236 GK24268-PA 1..228 1..227 844 71.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:17:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20398-PA 236 GE20398-PA 1..236 1..236 1099 91.5 Plus