Clone GH02734 Report

Search the DGRC for GH02734

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:27
Well:34
Vector:pOT2
Associated Gene/TranscriptCG32039-RA
Protein status:GH02734.pep: gold
Sequenced Size:622

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32039-RA 2009-01-21 est gleaning

Clone Sequence Records

GH02734.complete Sequence

622 bp assembled on 2009-01-21

GenBank Submission: BT058008.1

> GH02734.complete
CGAAAACCAAGCAAAATTCCAAAAGGAAGCCTTATTTTTCGAAAAAAAAA
ACTATAAACAAACCCATATTATAACTTATTCAATTCAATTTAACACCATG
GGAGCCTGTCTGTCCTGCTGCGGCCAAAGCGCCGAGGAAACCAACCTGAT
GCCATCGCCTGAGGAGCGCCGCCAGCAGCAGTTGGATGCGGCGGAAAAGC
GTCGCCAGGAGAATGAACATCGGGGCATTAAGAATCCGGACAGCGTACGC
CGACAGCAACAAAGAGCGGAGGAAATGCAACGCAGGGAGGAGGAGGCCGC
CCGTCAGGGTCAAGGACAATCCAATCTTAGGTGGCAAACTAGCTAAAAGG
AAGTGAACATCCATCCTGGTGTGGCTTATAAAGCACATCCAAATTTGTTC
CCACATCTTTACTGACTTTTGTGCAAAGTTTTTGTACTACTCCGTATTTG
TATTTGTATTGTATACACCTGTTTTTCCGATCTACATATTTCATGAATCT
TCAGAAAAGAACATCTTGGATTCAACACCATACAAACTTTTAGCTGGCGA
CCAAAATGTACAACCAAAAATAAAATTTAAACCAAATTGTTATCAGTGAT
CGTAAAAAAAAAAAAAAAAAAA

GH02734.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG32039-RA 904 CG32039-RA 53..660 1..608 3040 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:10:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9351388..9351660 331..603 1365 100 Plus
chr3L 24539361 chr3L 9351159..9351329 161..331 840 99.4 Plus
chr3L 24539361 chr3L 9350942..9351101 1..161 755 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:28:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:10:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9359475..9359752 331..608 1390 100 Plus
3L 28110227 3L 9359246..9359416 161..331 855 100 Plus
3L 28110227 3L 9359028..9359188 1..161 805 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9352575..9352852 331..608 1390 100 Plus
3L 28103327 3L 9352346..9352516 161..331 855 100 Plus
3L 28103327 3L 9352128..9352288 1..161 805 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:10:20 has no hits.

GH02734.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:11:31 Download gff for GH02734.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9351159..9351329 161..331 99 -> Plus
chr3L 9350942..9351100 1..160 99 -> Plus
chr3L 9351389..9351660 332..603 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:42 Download gff for GH02734.complete
Subject Subject Range Query Range Percent Splice Strand
CG32039-RA 1..249 98..346 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:28:51 Download gff for GH02734.complete
Subject Subject Range Query Range Percent Splice Strand
CG32039-RA 1..249 98..346 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:46:16 Download gff for GH02734.complete
Subject Subject Range Query Range Percent Splice Strand
CG32039-RA 1..249 98..346 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:31:53 Download gff for GH02734.complete
Subject Subject Range Query Range Percent Splice Strand
CG32039-RA 1..249 98..346 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-21 17:38:42 Download gff for GH02734.complete
Subject Subject Range Query Range Percent Splice Strand
CG32039-RA 6..608 1..603 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:28:51 Download gff for GH02734.complete
Subject Subject Range Query Range Percent Splice Strand
CG32039-RA 47..649 1..603 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:46:16 Download gff for GH02734.complete
Subject Subject Range Query Range Percent Splice Strand
CG32039-RA 30..632 1..603 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:31:53 Download gff for GH02734.complete
Subject Subject Range Query Range Percent Splice Strand
CG32039-RA 30..632 1..603 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:11:31 Download gff for GH02734.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9359028..9359187 1..160 100 -> Plus
3L 9359246..9359416 161..331 100 -> Plus
3L 9359476..9359747 332..603 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:11:31 Download gff for GH02734.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9359028..9359187 1..160 100 -> Plus
3L 9359246..9359416 161..331 100 -> Plus
3L 9359476..9359747 332..603 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:11:31 Download gff for GH02734.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9359028..9359187 1..160 100 -> Plus
3L 9359246..9359416 161..331 100 -> Plus
3L 9359476..9359747 332..603 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:46:16 Download gff for GH02734.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9352128..9352287 1..160 100 -> Plus
arm_3L 9352346..9352516 161..331 100 -> Plus
arm_3L 9352576..9352847 332..603 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:01:39 Download gff for GH02734.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9352576..9352847 332..603 100   Plus
3L 9352128..9352287 1..160 100 -> Plus
3L 9352346..9352516 161..331 100 -> Plus

GH02734.pep Sequence

Translation from 1 to 345

> GH02734.pep
ENQAKFQKEALFFEKKNYKQTHIITYSIQFNTMGACLSCCGQSAEETNLM
PSPEERRQQQLDAAEKRRQENEHRGIKNPDSVRRQQQRAEEMQRREEEAA
RQGQGQSNLRWQTS*

GH02734.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10683-PA 82 GF10683-PA 1..82 33..114 353 86.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15361-PA 82 GG15361-PA 1..82 33..114 402 96.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15175-PA 82 GH15175-PA 1..82 33..114 249 75.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG32039-PB 82 CG32039-PB 1..82 33..114 429 100 Plus
CG32039-PA 82 CG32039-PA 1..82 33..114 429 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12114-PA 82 GI12114-PA 1..82 33..114 319 76.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18432-PA 82 GL18432-PA 1..82 33..114 334 79.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16628-PA 82 GA16628-PA 1..82 33..114 334 79.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25133-PA 82 GM25133-PA 1..82 33..114 408 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14170-PA 82 GD14170-PA 1..82 33..114 414 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13388-PA 82 GJ13388-PA 1..82 33..114 306 74.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23844-PA 82 GK23844-PA 1..82 33..114 313 76.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:09:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20823-PA 82 GE20823-PA 1..82 33..114 406 96.3 Plus

GH02734.hyp Sequence

Translation from 1 to 345

> GH02734.hyp
ENQAKFQKEALFFEKKNYKQTHIITYSIQFNTMGACLSCCGQSAEETNLM
PSPEERRQQQLDAAEKRRQENEHRGIKNPDSVRRQQQRAEEMQRREEEAA
RQGQGQSNLRWQTS*

GH02734.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG32039-PB 82 CG32039-PB 1..82 33..114 429 100 Plus
CG32039-PA 82 CG32039-PA 1..82 33..114 429 100 Plus