Clone GH02759 Report

Search the DGRC for GH02759

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:27
Well:59
Vector:pOT2
Associated Gene/TranscriptSod2-RA
Protein status:GH02759.pep: gold
Preliminary Size:1300
Sequenced Size:911

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8905 2001-01-01 Release 2 assignment
CG8905 2003-01-01 Sim4 clustering to Release 3
CG8905 2003-02-17 Blastp of sequenced clone
Sod2 2008-04-29 Release 5.5 accounting
Sod2 2008-08-15 Release 5.9 accounting
Sod2 2008-12-18 5.12 accounting

Clone Sequence Records

GH02759.complete Sequence

911 bp (911 high quality bases) assembled on 2003-02-17

GenBank Submission: BT004505

> GH02759.complete
ATCTCTAGCAGTAAATTGTTCAAATAGAACAAGCGAAATAACGAGAACGT
AAGCCTTGTTTTATTTGATATAAAATCTGATATCGGGACTTAGCCTTATT
AGCAGTCGAATAAAACGCAGATATGTTCGTGGCCCGTAAAATTTCGCAAA
CTGCAAGCCTGGCGGTGCGTGGCAAGCACACCCTACCGAAGCTGCCCTAC
GACTATGCCGCCCTGGAGCCTATCATCTGCCGGGAGATCATGGAGCTGCA
TCACCAGAAGCACCACCAGACCTACGTCAACAATCTAAATGCCGCCGAGG
AGCAGCTGGAGGAGGCCAAGTCGAAGAGCGACACCACCAAGCTGATTCAG
CTGGCTCCTGCCCTGCGTTTCAATGGCGGTGGCCACATCAACCACACCAT
CTTCTGGCAGAACCTCTCGCCCAACAAGACCCAGCCCAGCGATGATCTGA
AGAAGGCCATCGAGTCGCAGTGGAAGAGCCTCGAGGAGTTCAAAAAGGAG
CTGACCACGCTGACCGTGGCGGTCCAGGGCTCCGGCTGGGGCTGGCTGGG
CTTCAACAAGAAGTCGGGCAAACTGCAACTGGCCGCCCTGCCCAACCAGG
ATCCCCTGGAGGCCTCCACCGGCCTGATCCCGCTCTTCGGCATCGATGTC
TGGGAGCACGCCTACTATCTGCAGTACAAGAACGTGCGTCCCTCCTACGT
GGAGGCCATCTGGGACATCGCCAACTGGGATGACATCTCGTGCCGCTTCC
AGGAGGCCAAGAAGCTCGGTTGCTAAGCACAGCCGGCGATTGCGTATGTT
TAATCTATAAGCATCTGCGGATCGGAGATCCTAAATTGTAGTCTAAGTTG
CGGCTAATAAATTGGTACCAGCTAGCAACTAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA

GH02759.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
Sod2-RA 1072 Sod2-RA 42..923 1..882 4410 100 Plus
Sod2.a 920 Sod2.a 90..869 103..882 3900 100 Plus
Sod2.b 795 Sod2.b 73..795 158..880 3615 100 Plus
Sod2.a 920 Sod2.a 42..89 1..48 240 100 Plus
Sod2.b 795 Sod2.b 25..72 1..48 240 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12660126..12660850 880..156 3625 100 Minus
chr2R 21145070 chr2R 12660965..12661121 157..1 785 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:28:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16772914..16773640 882..156 3635 100 Minus
2R 25286936 2R 16773755..16773911 157..1 785 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16774113..16774839 882..156 3635 100 Minus
2R 25260384 2R 16774954..16775110 157..1 785 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:09:02 has no hits.

GH02759.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:10:10 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12660965..12661121 1..157 100   Minus
chr2R 12660126..12660848 158..880 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:08:46 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
Sod2-RA 1..654 123..776 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:50:31 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
Sod2-RA 1..654 123..776 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:18:24 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
Sod2-RA 1..654 123..776 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:41:43 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
Sod2-RA 1..654 123..776 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:28:36 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
Sod2-RA 1..654 123..776 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:03:39 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
Sod2-RA 1..877 4..880 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:50:30 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
Sod2-RA 25..904 1..880 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:18:24 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
Sod2-RA 5..884 1..880 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:41:43 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
Sod2-RA 1..877 4..880 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:28:36 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
Sod2-RA 5..884 1..880 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:10 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16772916..16773638 158..880 100 <- Minus
2R 16773755..16773911 1..157 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:10 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16772916..16773638 158..880 100 <- Minus
2R 16773755..16773911 1..157 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:10 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16772916..16773638 158..880 100 <- Minus
2R 16773755..16773911 1..157 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:18:24 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12660421..12661143 158..880 100 <- Minus
arm_2R 12661260..12661416 1..157 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:12:19 Download gff for GH02759.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16774115..16774837 158..880 100 <- Minus
2R 16774954..16775110 1..157 100   Minus

GH02759.hyp Sequence

Translation from 122 to 775

> GH02759.hyp
MFVARKISQTASLAVRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQT
YVNNLNAAEEQLEEAKSKSDTTKLIQLAPALRFNGGGHINHTIFWQNLSP
NKTQPSDDLKKAIESQWKSLEEFKKELTTLTVAVQGSGWGWLGFNKKSGK
LQLAALPNQDPLEASTGLIPLFGIDVWEHAYYLQYKNVRPSYVEAIWDIA
NWDDISCRFQEAKKLGC*

GH02759.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:30:39
Subject Length Description Subject Range Query Range Score Percent Strand
Sod2-PB 217 CG8905-PB 1..217 1..217 1159 100 Plus
Sod2-PA 217 CG8905-PA 1..217 1..217 1159 100 Plus

GH02759.pep Sequence

Translation from 122 to 775

> GH02759.pep
MFVARKISQTASLAVRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQT
YVNNLNAAEEQLEEAKSKSDTTKLIQLAPALRFNGGGHINHTIFWQNLSP
NKTQPSDDLKKAIESQWKSLEEFKKELTTLTVAVQGSGWGWLGFNKKSGK
LQLAALPNQDPLEASTGLIPLFGIDVWEHAYYLQYKNVRPSYVEAIWDIA
NWDDISCRFQEAKKLGC*

GH02759.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13446-PA 208 GF13446-PA 1..208 1..217 1038 88.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22242-PA 217 GG22242-PA 1..217 1..217 1149 98.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22701-PA 215 GH22701-PA 1..214 1..215 1047 89.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
Sod2-PB 217 CG8905-PB 1..217 1..217 1159 100 Plus
Sod2-PA 217 CG8905-PA 1..217 1..217 1159 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18488-PA 217 GI18488-PA 1..216 1..215 1059 89.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11797-PA 218 GL11797-PA 1..216 1..215 1049 88.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21401-PB 218 GA21401-PB 1..216 1..215 1051 88.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20031-PA 217 GM20031-PA 1..217 1..217 1157 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25515-PA 217 GD25515-PA 1..217 1..217 1157 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21350-PA 217 GJ21350-PA 1..217 1..216 1028 86.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15671-PA 217 GK15671-PA 1..215 1..215 1046 87.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Sod2-PA 217 GE14035-PA 1..217 1..217 1144 97.2 Plus