Clone GH02773 Report

Search the DGRC for GH02773

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:27
Well:73
Vector:pOT2
Associated Gene/TranscriptReg-2-RA
Protein status:GH02773.pep: gold
Preliminary Size:1300
Sequenced Size:890

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3200 2001-01-01 Release 2 assignment
CG3200 2002-06-13 Blastp of sequenced clone
CG3200 2003-01-01 Sim4 clustering to Release 3
Reg-2 2008-04-29 Release 5.5 accounting
Reg-2 2008-08-15 Release 5.9 accounting
Reg-2 2008-12-18 5.12 accounting

Clone Sequence Records

GH02773.complete Sequence

890 bp (890 high quality bases) assembled on 2002-06-13

GenBank Submission: AY122086

> GH02773.complete
TTCGACGAGAGTCGAAAGTCAAGAGTTCTCGAGCGGCATTTCAGAGATTT
CAGGCAAAATGCGCAGCCTCAGCCGCTTTCGCCTCATAACCTTCGATGTG
ACCAACACTCTGCTCCAATTCCGAACCACTCCCGGCAAGCAGTACGGCGA
GATTGGAGCCCTGTTCGGAGCCCGATGCGACAACAACGAGCTGGCCAAGA
ACTTCAAGGCCAACTGGTACAAGATGAACCGCGATTATCCCAACTTTGGG
CGCGACACGAATCCCCAGATGGAATGGCAGCAATGGTGGCGTAAGCTGAT
AGCAGGAACTTTTGCGGAGAGTGGAGCGGCCATTCCCGACGAGAAGCTGC
ACAACTTCTCCAACCACCTAATTGAGCTATACAAAACCTCCATTTGCTGG
CAGCCATGCAACGGCAGCGTGGAACTCCTTCAGCAGCTCCGCAAGGAGTT
GAAGCCGGAGAAGTGCAAGCTGGGTGTGATAGCCAACTTCGATCCTCGGC
TGCCGACTCTGCTGCAGAACACCAAGCTGGATCAGTACCTGGACTTTGCA
ATTAACTCGTACGAGGTGCAGGCCGAGAAGCCCGACCCCCAAATCTTTCA
AAAGGCAATGGAGAAGTCGGGTCTGAAGAACCTCAAGCCGGAGGAGTGCC
TTCACATTGGGGATGGTCCCACCACTGATTATCTGGCCGCCAAGGAACTG
GGCTGGCACTCGGCGCTGGTGCACGAGAAGAGCTACGCATATCTGGTCAA
GAAATACGGCGAGGACATCGATCGAGATCATGTCTTCCCCAGTCTCTACG
ACTTCCACAAAAAGATCTCCGACGGCGCAGTTGTCTGGTGATTGATTGTG
CACACATTAAATTAGTAACACCAAAAAAAAAAAAAAAAAA

GH02773.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Reg-2-RA 1232 Reg-2-RA 236..1109 1..874 4370 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:47:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 605009..605576 869..302 2750 98.9 Minus
chr3L 24539361 chr3L 606185..606403 219..1 1035 98.2 Minus
chr3L 24539361 chr3L 606041..606131 306..216 455 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:28:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 605163..605735 874..302 2865 100 Minus
3L 28110227 3L 606340..606558 219..1 1095 100 Minus
3L 28110227 3L 606196..606286 306..216 455 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:20:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 605163..605735 874..302 2865 100 Minus
3L 28103327 3L 606340..606558 219..1 1095 100 Minus
3L 28103327 3L 606196..606286 306..216 455 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:47:32 has no hits.

GH02773.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:48:35 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 605006..605572 306..872 98 <- Minus
chr3L 606042..606130 217..305 100 <- Minus
chr3L 606188..606403 1..216 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:08:47 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
Reg-2-RA 1..783 59..841 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:21:48 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
Reg-2-RA 1..783 59..841 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:40:43 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
Reg-2-RA 1..783 59..841 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:12:36 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
Reg-2-RA 1..783 59..841 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:16:09 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
Reg-2-RA 1..783 59..841 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:48:07 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
Reg-2-RA 1..872 1..872 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:21:48 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
Reg-2-RA 12..883 1..872 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:40:43 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
Reg-2-RA 12..883 1..872 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:12:37 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
Reg-2-RA 1..872 1..872 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:16:09 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
Reg-2-RA 12..883 1..872 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:48:35 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
3L 605165..605731 306..872 100 <- Minus
3L 606197..606285 217..305 100 <- Minus
3L 606343..606558 1..216 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:48:35 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
3L 605165..605731 306..872 100 <- Minus
3L 606197..606285 217..305 100 <- Minus
3L 606343..606558 1..216 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:48:35 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
3L 605165..605731 306..872 100 <- Minus
3L 606197..606285 217..305 100 <- Minus
3L 606343..606558 1..216 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:40:43 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 605165..605731 306..872 100 <- Minus
arm_3L 606197..606285 217..305 100 <- Minus
arm_3L 606343..606558 1..216 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:45:19 Download gff for GH02773.complete
Subject Subject Range Query Range Percent Splice Strand
3L 605165..605731 306..872 100 <- Minus
3L 606197..606285 217..305 100 <- Minus
3L 606343..606558 1..216 100   Minus

GH02773.hyp Sequence

Translation from 1 to 840

> GH02773.hyp
STRVESQEFSSGISEISGKMRSLSRFRLITFDVTNTLLQFRTTPGKQYGE
IGALFGARCDNNELAKNFKANWYKMNRDYPNFGRDTNPQMEWQQWWRKLI
AGTFAESGAAIPDEKLHNFSNHLIELYKTSICWQPCNGSVELLQQLRKEL
KPEKCKLGVIANFDPRLPTLLQNTKLDQYLDFAINSYEVQAEKPDPQIFQ
KAMEKSGLKNLKPEECLHIGDGPTTDYLAAKELGWHSALVHEKSYAYLVK
KYGEDIDRDHVFPSLYDFHKKISDGAVVW*

GH02773.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
Reg-2-PA 260 CG3200-PA 1..260 20..279 1412 100 Plus
CG15912-PA 246 CG15912-PA 10..246 22..279 366 34 Plus

GH02773.pep Sequence

Translation from 58 to 840

> GH02773.pep
MRSLSRFRLITFDVTNTLLQFRTTPGKQYGEIGALFGARCDNNELAKNFK
ANWYKMNRDYPNFGRDTNPQMEWQQWWRKLIAGTFAESGAAIPDEKLHNF
SNHLIELYKTSICWQPCNGSVELLQQLRKELKPEKCKLGVIANFDPRLPT
LLQNTKLDQYLDFAINSYEVQAEKPDPQIFQKAMEKSGLKNLKPEECLHI
GDGPTTDYLAAKELGWHSALVHEKSYAYLVKKYGEDIDRDHVFPSLYDFH
KKISDGAVVW*

GH02773.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10059-PA 260 GF10059-PA 1..260 1..260 1291 89.6 Plus
Dana\GF19357-PA 249 GF19357-PA 8..249 1..260 407 34.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14654-PA 260 GG14654-PA 1..260 1..260 1360 95.8 Plus
Dere\GG18712-PA 246 GG18712-PA 10..220 3..221 369 36.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16592-PA 262 GH16592-PA 1..262 1..260 1106 74.4 Plus
Dgri\GH17703-PA 252 GH17703-PA 8..252 1..260 428 36 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Reg-2-PA 260 CG3200-PA 1..260 1..260 1412 100 Plus
CG15912-PA 246 CG15912-PA 10..246 3..260 366 34 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12439-PA 261 GI12439-PA 1..261 1..260 1174 82 Plus
Dmoj\GI16110-PA 262 GI16110-PA 8..262 1..260 416 34.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20848-PA 260 GL20848-PA 1..260 1..260 1303 90.8 Plus
Dper\GL20262-PA 251 GL20262-PA 8..223 1..224 430 39.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16604-PA 260 GA16604-PA 1..260 1..260 1303 90.8 Plus
Dpse\GA14022-PA 251 GA14022-PA 8..223 1..224 430 39.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14270-PA 260 GM14270-PA 1..260 1..260 1385 98.1 Plus
Dsec\GM12350-PA 246 GM12350-PA 10..246 3..260 377 34.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13525-PA 205 GD13525-PA 1..205 56..260 1088 97.6 Plus
Dsim\GD16695-PA 246 GD16695-PA 10..246 3..260 373 33.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12337-PA 261 GJ12337-PA 1..261 1..260 1180 81.2 Plus
Dvir\GJ15763-PA 251 GJ15763-PA 8..251 1..260 424 34.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16609-PA 267 GK16609-PA 1..267 1..260 1138 77.2 Plus
Dwil\GK25149-PA 255 GK25149-PA 8..255 1..260 433 36.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21014-PA 297 GE21014-PA 38..297 1..260 1372 95.8 Plus
Dyak\GE16351-PA 246 GE16351-PA 10..232 3..229 378 36.6 Plus