Clone GH02837 Report

Search the DGRC for GH02837

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:28
Well:37
Vector:pOT2
Associated Gene/TranscriptCG6290-RA
Protein status:GH02837.pep: gold
Preliminary Size:874
Sequenced Size:760

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6290 2001-01-01 Release 2 assignment
CG6290 2002-03-19 Blastp of sequenced clone
CG6290 2003-01-01 Sim4 clustering to Release 3
CG6290 2008-04-29 Release 5.5 accounting
CG6290 2008-08-15 Release 5.9 accounting
CG6290 2008-12-18 5.12 accounting

Clone Sequence Records

GH02837.complete Sequence

760 bp (760 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094668

> GH02837.complete
ATGAATCGCCATCAGCTGGCACTTCTCCTGGTTGTCGCGGGTCTGGCCAT
GATTGCGGCCAGGCCAGGTCCACAGAATCCGCTAGAGTCGCTGGGCATGG
GCGCCATGTCTCTGGCCGGAAATATAGCGGAGGCAGTTCAGAGTGGCGCC
GCCATCTCCCGCGACGTCGACATTGACAATCCCCTGATGTCCGTGCACTC
GAAAACGGCCGTTGGCTATGGAGATGCCATACGTCCCATTGCCACCGATT
CATCCGAGGAGGATCGTCGTCGGAAGCGAAGGCGGCGGAGCCTGCATCGC
CTCAAACGCGCTCCTTGCTTCTGGAAAATGAGCGCTGCCGCCACCACAGC
GGCGTCCGCCGACGATGACGTGGAGGCCAGACGGAGACGAGCTCAAAAGC
GGGCCGCCAACAATGCCTCCCGATCCCGAGTGAGTCCCAAGACCACTGGC
AAAAAGAACAAGAAGTTGGTGCGACGACGACGGCAGGAGGAGAAGGGCAT
GGAAGTGACACAGAATATGGACGGAGCGGATCCCTTGGGCCTGGGCACCA
GAATCAAGGCCATGTGGCTTTCGTTTGTGAACAACGTAGCGGATGTGGTG
CAGCAGGTGCGCCAGAAGATCACCGAAACGGCCAACTCCACGGCGTAGAA
TCACCGAGCTCCCTGACGACCACCATCGAGTGTATTTTTTTTGTTTGTTT
ATAAGTGCAATAAAATCAACTGAAAACCGGAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAA

GH02837.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG6290-RA 733 CG6290-RA 1..733 1..733 3665 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18326672..18327401 1..730 3620 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:28:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18437504..18438236 1..733 3665 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18445602..18446334 1..733 3665 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:51:56 has no hits.

GH02837.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:52:49 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18326672..18327401 1..730 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:08:57 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
CG6290-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:09 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
CG6290-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:54:42 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
CG6290-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:40 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
CG6290-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:52:49 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
CG6290-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:06:49 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
CG6290-RA 1..730 1..730 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:09 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
CG6290-RA 1..730 1..730 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:54:42 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
CG6290-RA 1..730 1..730 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:40 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
CG6290-RA 1..730 1..730 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:52:49 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
CG6290-RA 15..744 1..730 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:49 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
X 18437504..18438233 1..730 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:49 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
X 18437504..18438233 1..730 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:49 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
X 18437504..18438233 1..730 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:54:42 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18331537..18332266 1..730 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:20 Download gff for GH02837.complete
Subject Subject Range Query Range Percent Splice Strand
X 18445602..18446331 1..730 100   Plus

GH02837.pep Sequence

Translation from 0 to 647

> GH02837.pep
MNRHQLALLLVVAGLAMIAARPGPQNPLESLGMGAMSLAGNIAEAVQSGA
AISRDVDIDNPLMSVHSKTAVGYGDAIRPIATDSSEEDRRRKRRRRSLHR
LKRAPCFWKMSAAATTAASADDDVEARRRRAQKRAANNASRSRVSPKTTG
KKNKKLVRRRRQEEKGMEVTQNMDGADPLGLGTRIKAMWLSFVNNVADVV
QQVRQKITETANSTA*

GH02837.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22438-PA 213 GF22438-PA 1..208 1..213 552 63.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19166-PA 214 GG19166-PA 18..213 18..214 694 85.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12427-PA 231 GH12427-PA 7..223 9..211 274 43 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG6290-PA 215 CG6290-PA 1..215 1..215 1071 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26974-PA 219 GL26974-PA 21..208 24..208 360 54.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19491-PA 219 GA19491-PA 21..207 24..207 360 53.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22899-PA 215 GM22899-PA 1..214 1..214 753 86.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17395-PA 215 GD17395-PA 1..214 1..214 784 90.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15368-PA 239 GJ15368-PA 23..228 20..207 259 37.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25262-PA 222 GK25262-PA 13..210 6..214 407 57.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17728-PA 215 GE17728-PA 19..215 18..215 641 85.4 Plus

GH02837.hyp Sequence

Translation from 1 to 647

> GH02837.hyp
MNRHQLALLLVVAGLAMIAARPGPQNPLESLGMGAMSLAGNIAEAVQSGA
AISRDVDIDNPLMSVHSKTAVGYGDAIRPIATDSSEEDRRRKRRRRSLHR
LKRAPCFWKMSAAATTAASADDDVEARRRRAQKRAANNASRSRVSPKTTG
KKNKKLVRRRRQEEKGMEVTQNMDGADPLGLGTRIKAMWLSFVNNVADVV
QQVRQKITETANSTA*

GH02837.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG6290-PA 215 CG6290-PA 1..215 1..215 1071 100 Plus