Clone GH02880 Report

Search the DGRC for GH02880

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:28
Well:80
Vector:pOT2
Associated Gene/TranscriptPgam5-RA
Protein status:GH02880.pep: gold
Preliminary Size:1257
Sequenced Size:1104

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14816 2001-01-01 Release 2 assignment
CG14816 2003-01-01 Sim4 clustering to Release 3
CG14816 2003-01-13 Blastp of sequenced clone
CG14816 2008-04-29 Release 5.5 accounting
CG14816 2008-08-15 Release 5.9 accounting
CG14816 2008-12-18 5.12 accounting

Clone Sequence Records

GH02880.complete Sequence

1104 bp (1104 high quality bases) assembled on 2003-01-13

GenBank Submission: AY060608

> GH02880.complete
CGGCACGAGCCTAACGATGCGAAAGTTGACTAGCTTCGTGTGCGGCACAG
GAGCCGGACTGGCGGCTTACTACCTACAGCGGCTGCGGGACCCGCAGACG
GTCGTGCAGAACTCGTGGACGCACAGTGATAAGCCGGTGGATCCGTGGGC
CCTTTGGGACACCAACTGGGATTGCCGGGAGCCACGGGCCCTCGTGCGTC
CACTGCGAAACAGCCAGCCGGAGGAGGAGAACCGCTACAACGCGGAGCTT
GAGAAGGCGAAGGCCAAGAAGGCGCGCCACATTATCCTAGTGCGGCATGG
CGAGTATCTGGACGTGGGTGACTCGGATGACACGCATCATCTCACGGAGC
GCGGCCGCAAGCAGGCGGAGTTTACTGGGAAACGGCTCTGCGAGCTGGGC
ATCAAGTGGGACAAGGTAGTAGCCTCCACAATGGTGCGGGCCCAGGAGAC
TTCCGATATTATTCTCAAGCAGATCGATTTCGAAAAAGAGAAAGTGGTGA
ACTGTGCCTTCCTGCGTGAAGGAGCGCCTATTCCGCCCCAGCCGCCAGTC
GGCCACTGGAAGCCGGAGGCATCTCAGTTCCTTCGCGACGGATCGCGCAT
AGAGGCCGGCTTTCGCCGATACTTCCACCGCGCCTATCCCGACCAAGAGA
AGGAGAGCTATACCCTGATCGTGGGACACGGCAACGTGATCCGCTACTTT
GTCTGCCGAGCCCTGCAGTTCCCCGCCGAGGGTTGGCTACGGATTAACAT
TAATCACGCTTCCATCACCTGGCTGACCATCAGTCCATCCGGCAACGTGT
CCATCAAGTACCTGGGCGACTCCGGCTTTATGCCCGCCGAGCTGCTTACC
AATCGCATACCGCGCGACGTCAAAAACGTGGTTTAGCCGTCTGTTTATAG
AACTGCCCAAAGGAGAAGCAATCATAATGTATTTATTTCCAACACTTTAA
CTGAGACCTTGAGCACAGATCGCGAGACTGTGTAAACCACCATGTACATT
TTGCCGCACCGTAACGTATATCTCTTAAGGAGGAATCATTGAATCTTCCG
ACTGAAATAATAAAGATTTTATAGAATGCCTAAAAAAAAAAAAAAAAAAA
AAAA

GH02880.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
Pgam5-RA 1349 Pgam5-RA 234..1307 10..1083 5370 100 Plus
Pgam5.a 1208 Pgam5.a 96..1166 10..1083 5300 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1766816..1767380 574..10 2825 100 Minus
chrX 22417052 chrX 1766243..1766749 1081..575 2535 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:28:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1872973..1873537 574..10 2825 100 Minus
X 23542271 X 1872398..1872906 1083..575 2545 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1881071..1881635 574..10 2825 100 Minus
X 23527363 X 1880496..1881004 1083..575 2545 100 Minus
Blast to na_te.dros performed on 2019-03-15 12:49:02 has no hits.

GH02880.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:49:46 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1766243..1766749 575..1081 100 <- Minus
chrX 1766816..1767380 10..574 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:09:09 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
CG14816-RA 1..870 17..886 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:59:07 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pgam5-RA 1..870 17..886 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:50:25 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pgam5-RA 1..870 17..886 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:48 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
CG14816-RA 1..870 17..886 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:10:51 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pgam5-RA 1..870 17..886 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:15:54 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
CG14816-RA 1..1070 10..1079 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:59:07 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pgam5-RA 1..1070 10..1079 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:50:25 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pgam5-RA 29..1100 10..1081 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:49 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
CG14816-RA 1..1070 10..1079 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:10:51 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
Pgam5-RA 29..1100 10..1081 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:49:46 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
X 1872400..1872906 575..1081 100 <- Minus
X 1872973..1873537 10..574 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:49:46 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
X 1872400..1872906 575..1081 100 <- Minus
X 1872973..1873537 10..574 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:49:46 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
X 1872400..1872906 575..1081 100 <- Minus
X 1872973..1873537 10..574 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:50:25 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1766433..1766939 575..1081 100 <- Minus
arm_X 1767006..1767570 10..574 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:21:24 Download gff for GH02880.complete
Subject Subject Range Query Range Percent Splice Strand
X 1880498..1881004 575..1081 100 <- Minus
X 1881071..1881635 10..574 100   Minus

GH02880.hyp Sequence

Translation from 10 to 885

> GH02880.hyp
LTMRKLTSFVCGTGAGLAAYYLQRLRDPQTVVQNSWTHSDKPVDPWALWD
TNWDCREPRALVRPLRNSQPEEENRYNAELEKAKAKKARHIILVRHGEYL
DVGDSDDTHHLTERGRKQAEFTGKRLCELGIKWDKVVASTMVRAQETSDI
ILKQIDFEKEKVVNCAFLREGAPIPPQPPVGHWKPEASQFLRDGSRIEAG
FRRYFHRAYPDQEKESYTLIVGHGNVIRYFVCRALQFPAEGWLRININHA
SITWLTISPSGNVSIKYLGDSGFMPAELLTNRIPRDVKNVV*

GH02880.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:31:35
Subject Length Description Subject Range Query Range Score Percent Strand
Pgam5-PA 289 CG14816-PA 1..289 3..291 1553 100 Plus
Pgam5-PB 288 CG14816-PB 1..288 3..291 1536 99.7 Plus
Pgam5-2-PA 280 CG15874-PA 8..277 4..289 573 44.2 Plus

GH02880.pep Sequence

Translation from 16 to 885

> GH02880.pep
MRKLTSFVCGTGAGLAAYYLQRLRDPQTVVQNSWTHSDKPVDPWALWDTN
WDCREPRALVRPLRNSQPEEENRYNAELEKAKAKKARHIILVRHGEYLDV
GDSDDTHHLTERGRKQAEFTGKRLCELGIKWDKVVASTMVRAQETSDIIL
KQIDFEKEKVVNCAFLREGAPIPPQPPVGHWKPEASQFLRDGSRIEAGFR
RYFHRAYPDQEKESYTLIVGHGNVIRYFVCRALQFPAEGWLRININHASI
TWLTISPSGNVSIKYLGDSGFMPAELLTNRIPRDVKNVV*

GH02880.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21073-PA 289 GF21073-PA 1..289 1..289 1345 83.4 Plus
Dana\GF11250-PA 287 GF11250-PA 72..273 79..282 562 54.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12675-PA 289 GG12675-PA 1..289 1..289 1506 96.2 Plus
Dere\GG19931-PA 280 GG19931-PA 8..276 2..286 578 44.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24297-PA 289 GH24297-PA 1..289 1..289 1264 77.9 Plus
Dgri\GH20896-PA 266 GH20896-PA 76..266 87..279 562 57.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:53
Subject Length Description Subject Range Query Range Score Percent Strand
Pgam5-PA 289 CG14816-PA 1..289 1..289 1553 100 Plus
Pgam5-PB 288 CG14816-PB 1..288 1..289 1536 99.7 Plus
Pgam5-2-PA 280 CG15874-PA 8..277 2..287 573 44.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16420-PA 289 GI16420-PA 1..289 1..289 1258 76.8 Plus
Dmoj\GI18906-PA 278 GI18906-PA 48..275 47..284 577 51 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20215-PA 289 GL20215-PA 1..289 1..289 1267 77.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13269-PA 289 GA13269-PA 1..289 1..289 1269 77.9 Plus
Dpse\GA13996-PA 267 GA13996-PA 40..251 47..275 564 50.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18947-PA 289 GM18947-PA 1..289 1..289 1548 99 Plus
Dsec\GM11831-PA 135 GM11831-PA 8..132 2..143 186 36.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16411-PA 289 GD16411-PA 1..289 1..289 1547 99 Plus
Dsim\GD24953-PA 153 GD24953-PA 1..151 139..288 414 53 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17041-PA 289 GJ17041-PA 1..289 1..289 1288 79.2 Plus
Dvir\GJ20730-PA 274 GJ20730-PA 10..273 4..286 601 47.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25607-PA 291 GK25607-PA 1..291 1..289 1321 80.8 Plus
Dwil\GK19686-PA 282 GK19686-PA 7..279 1..285 597 44.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16503-PA 289 GE16503-PA 1..289 1..289 1502 95.8 Plus
Dyak\GE11458-PA 273 GE11458-PA 8..273 2..283 572 44.4 Plus