Clone GH02930 Report

Search the DGRC for GH02930

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:29
Well:30
Vector:pOT2
Associated Gene/TranscriptCG17648-RA
Protein status:GH02930.pep: gold
Preliminary Size:486
Sequenced Size:500

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17648 2002-01-01 Sim4 clustering to Release 2
CG17648 2002-05-18 Blastp of sequenced clone
CG17648 2003-01-01 Sim4 clustering to Release 3
CG17648 2008-04-29 Release 5.5 accounting
CG17648 2008-08-15 Release 5.9 accounting
CG17648 2008-12-18 5.12 accounting

Clone Sequence Records

GH02930.complete Sequence

500 bp (500 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118727

> GH02930.complete
AAAATATCAAATTTCAAATGATTTCGATTGCTCAGTTGCTGACCTCTTTT
ACGGCCGGAGCCTTGGCCTCTGCACAGGCGATTCGTTTTCTAAAAACTGC
CAACGAGGAGGAGTCGCCGGCCAAAATTTCAAGCCAGCTGGAAACTGCGG
TCATCGATGGACTGGCCACCGAGCAACCGAAGATCCTGGGCTCCGAACAG
ATCAGCAATGTCATGCAGCACATTCTGAGCAGCGAGCGCAATGCGAGTGG
CGTCTACTTGGACGCCATGCACAACCGAAGTGCCAATAAGCAGGAGTACG
CTCTGGGCTCCGAGTCGCTCAACCAAATGCTGGAGGACATCATGACCCCC
GCCGGGAGTGTGAGCAGCAGGTCCTTGTCCATGGAACCCGCCGTCGAAGC
CTAGAAGTTTCTAAAACTATTTTTAAAAAATACTTTCTTTTTTCTCTGCT
TAGAATCAAATGAACCTGTGAGATTAGGCCAACAAAAAAAAAAAAAAAAA

GH02930.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG17648-RA 503 CG17648-RA 18..503 1..486 2430 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1752179..1752661 1..483 2370 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:28:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1752366..1752851 1..486 2430 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1752366..1752851 1..486 2430 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:13:57 has no hits.

GH02930.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:14:57 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1752179..1752661 1..483 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:09:17 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
CG17648-RA 1..387 18..404 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:45:55 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
CG17648-RA 1..387 18..404 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:50 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
CG17648-RA 1..387 18..404 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:39:02 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
CG17648-RA 1..387 18..404 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:03:39 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
CG17648-RA 1..387 18..404 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:22:29 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
CG17648-RA 18..500 1..483 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:45:55 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
CG17648-RA 18..500 1..483 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:50 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
CG17648-RA 59..541 1..483 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:39:02 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
CG17648-RA 18..500 1..483 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:03:39 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
CG17648-RA 59..541 1..483 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:14:57 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1752366..1752848 1..483 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:14:57 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1752366..1752848 1..483 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:14:57 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1752366..1752848 1..483 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:50 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1752366..1752848 1..483 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:10:33 Download gff for GH02930.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1752366..1752848 1..483 100   Plus

GH02930.hyp Sequence

Translation from 2 to 403

> GH02930.hyp
NIKFQMISIAQLLTSFTAGALASAQAIRFLKTANEEESPAKISSQLETAV
IDGLATEQPKILGSEQISNVMQHILSSERNASGVYLDAMHNRSANKQEYA
LGSESLNQMLEDIMTPAGSVSSRSLSMEPAVEA*

GH02930.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17648-PA 128 CG17648-PA 1..128 6..133 612 100 Plus

GH02930.pep Sequence

Translation from 17 to 403

> GH02930.pep
MISIAQLLTSFTAGALASAQAIRFLKTANEEESPAKISSQLETAVIDGLA
TEQPKILGSEQISNVMQHILSSERNASGVYLDAMHNRSANKQEYALGSES
LNQMLEDIMTPAGSVSSRSLSMEPAVEA*

GH02930.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14009-PA 129 GF14009-PA 1..129 1..128 377 56.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24809-PA 128 GG24809-PA 1..128 1..128 613 92.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25254-PA 129 GH25254-PA 1..128 1..127 160 37.9 Plus
Dgri\GH25022-PA 129 GH25022-PA 1..128 1..127 160 37.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG17648-PA 128 CG17648-PA 1..128 1..128 612 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17276-PA 131 GI17276-PA 1..130 1..127 177 39.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19655-PA 144 GL19655-PA 1..140 1..124 251 41.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14595-PA 146 GA14595-PA 3..142 1..124 250 43.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16833-PA 128 GM16833-PA 1..128 1..128 624 95.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23113-PA 128 GD23113-PA 1..128 1..128 627 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22821-PA 104 GJ22821-PA 1..104 1..108 175 41.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14560-PA 126 GK14560-PA 1..124 1..126 162 36.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17725-PA 128 GE17725-PA 1..128 1..128 607 91.4 Plus