BDGP Sequence Production Resources |
Search the DGRC for GH02930
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 29 |
Well: | 30 |
Vector: | pOT2 |
Associated Gene/Transcript | CG17648-RA |
Protein status: | GH02930.pep: gold |
Preliminary Size: | 486 |
Sequenced Size: | 500 |
Gene | Date | Evidence |
---|---|---|
CG17648 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17648 | 2002-05-18 | Blastp of sequenced clone |
CG17648 | 2003-01-01 | Sim4 clustering to Release 3 |
CG17648 | 2008-04-29 | Release 5.5 accounting |
CG17648 | 2008-08-15 | Release 5.9 accounting |
CG17648 | 2008-12-18 | 5.12 accounting |
500 bp (500 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118727
> GH02930.complete AAAATATCAAATTTCAAATGATTTCGATTGCTCAGTTGCTGACCTCTTTT ACGGCCGGAGCCTTGGCCTCTGCACAGGCGATTCGTTTTCTAAAAACTGC CAACGAGGAGGAGTCGCCGGCCAAAATTTCAAGCCAGCTGGAAACTGCGG TCATCGATGGACTGGCCACCGAGCAACCGAAGATCCTGGGCTCCGAACAG ATCAGCAATGTCATGCAGCACATTCTGAGCAGCGAGCGCAATGCGAGTGG CGTCTACTTGGACGCCATGCACAACCGAAGTGCCAATAAGCAGGAGTACG CTCTGGGCTCCGAGTCGCTCAACCAAATGCTGGAGGACATCATGACCCCC GCCGGGAGTGTGAGCAGCAGGTCCTTGTCCATGGAACCCGCCGTCGAAGC CTAGAAGTTTCTAAAACTATTTTTAAAAAATACTTTCTTTTTTCTCTGCT TAGAATCAAATGAACCTGTGAGATTAGGCCAACAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17648-RA | 503 | CG17648-RA | 18..503 | 1..486 | 2430 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 1752179..1752661 | 1..483 | 2370 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 1752366..1752851 | 1..486 | 2430 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 1752366..1752851 | 1..486 | 2430 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 1752179..1752661 | 1..483 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17648-RA | 1..387 | 18..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17648-RA | 1..387 | 18..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17648-RA | 1..387 | 18..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17648-RA | 1..387 | 18..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17648-RA | 1..387 | 18..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17648-RA | 18..500 | 1..483 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17648-RA | 18..500 | 1..483 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17648-RA | 59..541 | 1..483 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17648-RA | 18..500 | 1..483 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17648-RA | 59..541 | 1..483 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1752366..1752848 | 1..483 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1752366..1752848 | 1..483 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1752366..1752848 | 1..483 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 1752366..1752848 | 1..483 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1752366..1752848 | 1..483 | 100 | Plus |
Translation from 2 to 403
> GH02930.hyp NIKFQMISIAQLLTSFTAGALASAQAIRFLKTANEEESPAKISSQLETAV IDGLATEQPKILGSEQISNVMQHILSSERNASGVYLDAMHNRSANKQEYA LGSESLNQMLEDIMTPAGSVSSRSLSMEPAVEA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17648-PA | 128 | CG17648-PA | 1..128 | 6..133 | 612 | 100 | Plus |
Translation from 17 to 403
> GH02930.pep MISIAQLLTSFTAGALASAQAIRFLKTANEEESPAKISSQLETAVIDGLA TEQPKILGSEQISNVMQHILSSERNASGVYLDAMHNRSANKQEYALGSES LNQMLEDIMTPAGSVSSRSLSMEPAVEA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14009-PA | 129 | GF14009-PA | 1..129 | 1..128 | 377 | 56.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24809-PA | 128 | GG24809-PA | 1..128 | 1..128 | 613 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH25254-PA | 129 | GH25254-PA | 1..128 | 1..127 | 160 | 37.9 | Plus |
Dgri\GH25022-PA | 129 | GH25022-PA | 1..128 | 1..127 | 160 | 37.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17648-PA | 128 | CG17648-PA | 1..128 | 1..128 | 612 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17276-PA | 131 | GI17276-PA | 1..130 | 1..127 | 177 | 39.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19655-PA | 144 | GL19655-PA | 1..140 | 1..124 | 251 | 41.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14595-PA | 146 | GA14595-PA | 3..142 | 1..124 | 250 | 43.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16833-PA | 128 | GM16833-PA | 1..128 | 1..128 | 624 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23113-PA | 128 | GD23113-PA | 1..128 | 1..128 | 627 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22821-PA | 104 | GJ22821-PA | 1..104 | 1..108 | 175 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14560-PA | 126 | GK14560-PA | 1..124 | 1..126 | 162 | 36.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17725-PA | 128 | GE17725-PA | 1..128 | 1..128 | 607 | 91.4 | Plus |