Clone GH02938 Report

Search the DGRC for GH02938

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:29
Well:38
Vector:pOT2
Associated Gene/TranscriptCG1537-RA
Protein status:GH02938.pep: gold
Preliminary Size:981
Sequenced Size:830

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1537 2002-01-01 Sim4 clustering to Release 2
CG1537 2002-05-01 Blastp of sequenced clone
CG1537 2003-01-01 Sim4 clustering to Release 3
CG1537 2008-04-29 Release 5.5 accounting
CG1537 2008-08-15 Release 5.9 accounting
CG1537 2008-12-18 5.12 accounting

Clone Sequence Records

GH02938.complete Sequence

830 bp (830 high quality bases) assembled on 2002-05-01

GenBank Submission: AY102654

> GH02938.complete
CAGGGGCGACATTCGCAGCGGCAACGAAAGCGACAGCCATAGCATACCCA
TCCATCTACCTATACACTTGCACATTGTCACCTGGCACCTGGCACCCATA
CATACGCAGATCACCAACACAAACGCAGACACTGTTAAAAAGAGAGAGTG
CGGGAGAGAGAATTCAAGAAAGTGATCAAGAAGGAAAGCTAGAAAGGCGG
TGTGTGTGCGTTTGTGCGTTTGTGTGTTTGTGAATGCACGCCGGAAATGG
CCAAATTAGTGACTTACATCTTCATCGTCAGCTCCCTGGTCCTCTGGTAC
CTCCTGCTTTTCGGTGGCAGGGGCGTCAGAGGCGTGGAGGCCACCAACGG
GCACGGGGGTCAGCTGGAGGGACGGGACTTTCATCACCATGGCGGCAGTC
ACCACATTCGCCGTAACATTAACCATTGCTGGCGCCGTTACGATGGCTAC
AATCTGCAGAACACTGTGGTCAACAAAAAGGAGCAGCTGAAGAAGCCCTA
TGGCATATTGTGCAACTTCAAGTGCACCTGGTTCTTCACCGTCAGCTTCC
CCACTTGCGAGTTCATCTACGATTATAAGTTATCCTGCGTGCTGTTCACT
TCACTGCCCGACTGTACCAGCGTCCAGTGTACGCTTATGAATTACTTCGA
TTAACTATGTTAGTGTATCTATTTAAGTATCTTTTTTTTGATAGCCTAAG
TCTGATTAATACTAGATTTTATATGGACATGTAGTGCGATTTAGAAAGAA
AGTATTATTAAATCAAAAGACCTAATTTATGAGAACGAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH02938.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG1537-RA 902 CG1537-RA 110..898 1..789 3945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:29:36
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10953932..10954347 416..1 2065 99.8 Minus
chrX 22417052 chrX 10953286..10953530 787..543 1210 99.6 Minus
chrX 22417052 chrX 10953590..10953722 545..413 665 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:28:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:29:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11062673..11063088 416..1 2080 100 Minus
X 23542271 X 11062025..11062271 789..543 1235 100 Minus
X 23542271 X 11062331..11062463 545..413 665 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11070771..11071186 416..1 2080 100 Minus
X 23527363 X 11070123..11070369 789..543 1235 100 Minus
X 23527363 X 11070429..11070561 545..413 665 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:29:34 has no hits.

GH02938.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:30:33 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10953286..10953527 546..787 99 <- Minus
chrX 10953590..10953722 413..545 100 <- Minus
chrX 10953936..10954347 1..412 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:09:19 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
CG1537-RA 1..408 247..654 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:53:48 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
CG1537-RA 1..408 247..654 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:49:59 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
CG1537-RA 1..408 247..654 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:19 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
CG1537-RA 1..408 247..654 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:55:16 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
CG1537-RA 1..408 247..654 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:32:20 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
CG1537-RA 1..784 4..787 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:53:48 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
CG1537-RA 1..784 4..787 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:49:59 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
CG1537-RA 83..869 1..787 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:19 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
CG1537-RA 1..784 4..787 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:55:16 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
CG1537-RA 83..869 1..787 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:33 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
X 11062027..11062268 546..787 100 <- Minus
X 11062331..11062463 413..545 100 <- Minus
X 11062677..11063088 1..412 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:33 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
X 11062027..11062268 546..787 100 <- Minus
X 11062331..11062463 413..545 100 <- Minus
X 11062677..11063088 1..412 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:33 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
X 11062027..11062268 546..787 100 <- Minus
X 11062331..11062463 413..545 100 <- Minus
X 11062677..11063088 1..412 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:49:59 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10956060..10956301 546..787 100 <- Minus
arm_X 10956364..10956496 413..545 100 <- Minus
arm_X 10956710..10957121 1..412 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:18:52 Download gff for GH02938.complete
Subject Subject Range Query Range Percent Splice Strand
X 11070125..11070366 546..787 100 <- Minus
X 11070429..11070561 413..545 100 <- Minus
X 11070775..11071186 1..412 100   Minus

GH02938.pep Sequence

Translation from 246 to 653

> GH02938.pep
MAKLVTYIFIVSSLVLWYLLLFGGRGVRGVEATNGHGGQLEGRDFHHHGG
SHHIRRNINHCWRRYDGYNLQNTVVNKKEQLKKPYGILCNFKCTWFFTVS
FPTCEFIYDYKLSCVLFTSLPDCTSVQCTLMNYFD*

GH02938.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20398-PA 142 GF20398-PA 1..142 1..135 620 85.9 Plus
Dana\GF20399-PA 149 GF20399-PA 72..136 59..128 138 38.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18884-PA 138 GG18884-PA 1..138 1..135 707 97.1 Plus
Dere\GG18885-PA 84 GG18885-PA 7..71 59..128 136 37.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17595-PA 140 GH17595-PA 1..140 1..135 660 87.1 Plus
Dgri\GH17596-PA 123 GH17596-PA 45..109 59..128 138 37.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG1537-PA 135 CG1537-PA 1..135 1..135 760 100 Plus
CG1545-PB 128 CG1545-PB 51..115 59..128 148 37.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16460-PA 134 GI16460-PA 1..134 1..135 640 85.2 Plus
Dmoj\GI16462-PA 86 GI16462-PA 9..73 59..128 138 37.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18314-PA 133 GL18314-PA 1..133 1..135 654 89.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13678-PA 133 GA13678-PA 1..133 1..135 654 89.6 Plus
Dpse\GA13738-PA 150 GA13738-PA 72..136 59..128 143 38.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:18:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11267-PA 135 GM11267-PA 1..135 1..135 723 99.3 Plus
Dsec\GM11268-PA 161 GM11268-PA 84..148 59..128 141 37.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:18:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16003-PA 135 GD16003-PA 1..135 1..135 723 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15938-PA 141 GJ15938-PA 1..141 1..135 607 85.1 Plus
Dvir\GJ15939-PA 173 GJ15939-PA 96..160 59..128 139 37.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19896-PA 133 GK19896-PA 1..133 1..135 666 91.9 Plus
Dwil\GK19382-PA 144 GK19382-PA 67..131 59..128 141 38.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17324-PA 135 GE17324-PA 1..135 1..135 722 99.3 Plus
Dyak\GE17325-PA 161 GE17325-PA 84..148 59..128 141 37.1 Plus

GH02938.hyp Sequence

Translation from 246 to 653

> GH02938.hyp
MAKLVTYIFIVSSLVLWYLLLFGGRGVRGVEATNGHGGQLEGRDFHHHGG
SHHIRRNINHCWRRYDGYNLQNTVVNKKEQLKKPYGILCNFKCTWFFTVS
FPTCEFIYDYKLSCVLFTSLPDCTSVQCTLMNYFD*

GH02938.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG1537-PA 135 CG1537-PA 1..135 1..135 760 100 Plus
CG1545-PB 128 CG1545-PB 51..115 59..128 148 37.1 Plus