Clone GH03296 Report

Search the DGRC for GH03296

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:32
Well:96
Vector:pOT2
Associated Gene/TranscriptCG6154-RC
Protein status:GH03296.pep: gold
Sequenced Size:1601

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6154 2008-04-29 Release 5.5 accounting
CG6154 2008-04-29 Picked prior to 5.5
CG6154 2008-08-15 Release 5.9 accounting
CG6154 2008-12-18 5.12 accounting

Clone Sequence Records

GH03296.complete Sequence

1601 bp assembled on 2007-11-15

GenBank Submission: BT031191

> GH03296.complete
TCAAAGTTGAACACAATTTTTCTAGAAGGCCGAACACCATCAATGTGAGT
GCTGCGGAGTGCGTGCTCTTCCACTAGAGCTCCGAGCCGCTCGGGGGCAA
TGAAATCGCGGAAGCTGCCAAAGGGCTTCGTGCTTTGTGGCCTCAACTGT
TTGACCTTCGTCTACTTCCCGCTCGTCCTGCCAATCCTGCGATGCTCGGC
CGGAGCGGCGTCGTCGGCCAGCGGCGGTGGCTCAAAGACCGCCGACGACT
TCGACTTCCGGATGCAGCGCGTGCGGAATGTCCTGAAGGAAGTGCCCCTC
ATCGACGGACACAACGATCTGCCGTGGAATATTCGCAAGTTTCTGAAGAA
CCAACTGAAGGACTTCCACTTTGGCGGCGATCTGCGGGAACTGGCTCCCT
GGTCGTCGAGTGCCTGGAGTCACACAGACCTGCGCCGCCTGAAGGAGGGC
ATGGTCTCCGCCCAGTTCTGGTCCGCCTATGCCCCCTGCTCATCCCAACA
TCTGGATGCAGTGCAGCTGACGCTGGAGCAGATCGACCTGATTCGTCGAC
TTGTTCAGCTCTATCCGCATCACATGGCGCTGGTCACGACTGCTTCTGGA
ATCGAGCAGACGCACCGGACTGGCAAGATCGCCAGTCTCATTGGCGTGGA
GGGCGGACATGCCATCGGCACCAGTCTGAGTGTCCTGCGAATGTTCTACC
AACTGGGCGCCAGATACTTGACTCTCACACACACCTGCAATACACCTTGG
GCGGACTGCTGCAAAGTTGACGAACCAGGGAAGTACCCGCACATAGGCGG
TCTTTCGCAGTTCGGCAAGCTGGTGGTCAAGGAGATGAACCGACTGGGGA
TGATAGTGGATCTGTCTCACGTCTCGGTGCCCACGATGCTGGATGCCCTG
GCCGCCTCGAGGGCGCCGTTAATATTCTCGCACTCCTCGGCGCACGCCAT
CTGCAATAGTTCCCGCAACGTTCCCGATCATGTCCTGCAACGCATTGCAA
TAAACGGCGGTCTGGTTATGGTGGCCTTTTATCCGCATTTCGTCAGCTGC
TCGGGACAGGCGACATTGCACGATGTTGTGGCGCATATCAACCACATAAG
GGAGGTGGCCGGCATCGATCATGTTGGCATTGGAGCTGGCTACGACGGAG
TCAACTTAGTGCCCAAAGGACTGGAGGATGTGTCCAAATATCCGCATCTT
TTTGCTGCCCTGCTCGAGTCTGATAAATGGTCGGAGGAGGATATTGCCAA
GTTGGCTGGCAGGAATCTAATACGTGTATTCAAGGAAGTCGAAGCGGTGC
GCGATCAAATGGAACTTTTGCGAGTGGCACCCATTGATCAGTCAATTCCA
GCCGAAGACATTATGGGCCGATCCTATTGTCGTTATCAAGGACCAAGAAC
GTGATAATTTCTCCATTTGTAAAGTTCACCCATATGCATAGCGTTTCATT
CATCGCAAAACTGTGGCGAAAATGGCTAAAAATTATGTCAAGCGTACGTG
TTGTAAAGTGAAACTTGTTTTAGGTTAATTGACAAAGTTTTCCTCCTCTC
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
A

GH03296.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:32:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG6154-RC 1737 CG6154-RC 49..1599 1..1551 7755 100 Plus
CG6154.a 2278 CG6154.a 49..1599 1..1551 7755 100 Plus
CG6154-RD 3916 CG6154-RD 362..1896 17..1551 7660 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:11:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22091432..22092160 22..750 3645 100 Plus
chr3R 27901430 chr3R 22097842..22098096 1296..1550 1275 100 Plus
chr3R 27901430 chr3R 22092366..22092545 818..997 900 100 Plus
chr3R 27901430 chr3R 22093008..22093149 1158..1299 710 100 Plus
chr3R 27901430 chr3R 22092623..22092707 997..1081 425 100 Plus
chr3R 27901430 chr3R 22092797..22092873 1081..1157 385 100 Plus
chr3R 27901430 chr3R 22092231..22092301 749..819 355 100 Plus
chr2L 23010047 chr2L 18191664..18191737 536..463 205 85.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:29:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26268374..26269102 22..750 3645 100 Plus
3R 32079331 3R 26274775..26275030 1296..1551 1280 100 Plus
3R 32079331 3R 26269308..26269487 818..997 900 100 Plus
3R 32079331 3R 26269950..26270091 1158..1299 710 100 Plus
3R 32079331 3R 26269565..26269649 997..1081 425 100 Plus
3R 32079331 3R 26269739..26269815 1081..1157 385 100 Plus
3R 32079331 3R 26269173..26269243 749..819 355 100 Plus
2L 23513712 2L 18192994..18193067 536..463 205 85.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26009205..26009933 22..750 3645 100 Plus
3R 31820162 3R 26015606..26015861 1296..1551 1280 100 Plus
3R 31820162 3R 26010139..26010318 818..997 900 100 Plus
3R 31820162 3R 26010781..26010922 1158..1299 710 100 Plus
3R 31820162 3R 26010396..26010480 997..1081 425 100 Plus
3R 31820162 3R 26010570..26010646 1081..1157 385 100 Plus
3R 31820162 3R 26010004..26010074 749..819 355 100 Plus
2L 23513712 2L 18192994..18193067 536..463 205 85.1 Minus
2L 23513712 2L 18200813..18200889 366..290 160 80.5 Minus
Blast to na_te.dros performed on 2019-03-15 15:11:26 has no hits.

GH03296.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:12:14 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22091436..22092159 26..749 100 -> Plus
chr3R 22092232..22092301 750..819 100 -> Plus
chr3R 22092368..22092544 820..996 100 -> Plus
chr3R 22092623..22092707 997..1081 100 -> Plus
chr3R 22092798..22092873 1082..1157 100 -> Plus
chr3R 22093008..22093146 1158..1296 100 -> Plus
chr3R 22097843..22098096 1297..1550 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:10:20 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
CG6154-RD 1..1305 100..1404 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:01:44 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
CG6154-RD 1..1305 100..1404 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:06:27 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
CG6154-RC 1..1305 100..1404 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:47:09 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
CG6154-RB 1..1208 100..1305 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:30:44 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
CG6154-RC 1..1305 100..1404 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:45:56 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
CG6154-RC 1..1547 4..1550 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:01:44 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
CG6154-RC 1..1547 4..1550 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:06:27 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
CG6154-RC 1..1547 4..1550 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:47:09 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
CG6154-RB 1..1304 4..1305 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:30:44 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
CG6154-RC 1..1547 4..1550 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:12:14 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26269565..26269649 997..1081 100 -> Plus
3R 26269740..26269815 1082..1157 100 -> Plus
3R 26269950..26270088 1158..1296 100 -> Plus
3R 26268287..26268307 1..21 100 -> Plus
3R 26268374..26269101 22..749 100 -> Plus
3R 26269174..26269243 750..819 100 -> Plus
3R 26269310..26269486 820..996 100 -> Plus
3R 26274776..26275029 1297..1550 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:12:14 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26269565..26269649 997..1081 100 -> Plus
3R 26269740..26269815 1082..1157 100 -> Plus
3R 26269950..26270088 1158..1296 100 -> Plus
3R 26268287..26268307 1..21 100 -> Plus
3R 26268374..26269101 22..749 100 -> Plus
3R 26269174..26269243 750..819 100 -> Plus
3R 26269310..26269486 820..996 100 -> Plus
3R 26274776..26275029 1297..1550 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:12:14 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26269565..26269649 997..1081 100 -> Plus
3R 26269740..26269815 1082..1157 100 -> Plus
3R 26269950..26270088 1158..1296 100 -> Plus
3R 26268287..26268307 1..21 100 -> Plus
3R 26268374..26269101 22..749 100 -> Plus
3R 26269174..26269243 750..819 100 -> Plus
3R 26269310..26269486 820..996 100 -> Plus
3R 26274776..26275029 1297..1550 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:06:27 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22094009..22094029 1..21 100 -> Plus
arm_3R 22094096..22094823 22..749 100 -> Plus
arm_3R 22094896..22094965 750..819 100 -> Plus
arm_3R 22095032..22095208 820..996 100 -> Plus
arm_3R 22095287..22095371 997..1081 100 -> Plus
arm_3R 22095462..22095537 1082..1157 100 -> Plus
arm_3R 22095672..22095810 1158..1296 100 -> Plus
arm_3R 22100498..22100751 1297..1550 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:53:39 Download gff for GH03296.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26010005..26010074 750..819 100 -> Plus
3R 26010571..26010646 1082..1157 100 -> Plus
3R 26010141..26010317 820..996 100 -> Plus
3R 26010396..26010480 997..1081 100 -> Plus
3R 26009205..26009932 22..749 100 -> Plus
3R 26010781..26010919 1158..1296 100 -> Plus
3R 26015607..26015860 1297..1550 100   Plus
3R 26009118..26009138 1..21 100 -> Plus

GH03296.pep Sequence

Translation from 99 to 1403

> GH03296.pep
MKSRKLPKGFVLCGLNCLTFVYFPLVLPILRCSAGAASSASGGGSKTADD
FDFRMQRVRNVLKEVPLIDGHNDLPWNIRKFLKNQLKDFHFGGDLRELAP
WSSSAWSHTDLRRLKEGMVSAQFWSAYAPCSSQHLDAVQLTLEQIDLIRR
LVQLYPHHMALVTTASGIEQTHRTGKIASLIGVEGGHAIGTSLSVLRMFY
QLGARYLTLTHTCNTPWADCCKVDEPGKYPHIGGLSQFGKLVVKEMNRLG
MIVDLSHVSVPTMLDALAASRAPLIFSHSSAHAICNSSRNVPDHVLQRIA
INGGLVMVAFYPHFVSCSGQATLHDVVAHINHIREVAGIDHVGIGAGYDG
VNLVPKGLEDVSKYPHLFAALLESDKWSEEDIAKLAGRNLIRVFKEVEAV
RDQMELLRVAPIDQSIPAEDIMGRSYCRYQGPRT*

GH03296.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18954-PA 403 GF18954-PA 1..398 1..399 2089 98.2 Plus
Dana\GF24505-PA 523 GF24505-PA 166..520 64..429 1055 53.3 Plus
Dana\GF14853-PA 183 GF14853-PA 1..168 246..414 553 62.1 Plus
Dana\GF24137-PA 451 GF24137-PA 91..448 29..429 546 31.7 Plus
Dana\GF14854-PA 809 GF14854-PA 275..393 122..240 345 53.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11471-PA 434 GG11471-PA 1..434 1..434 2322 99.8 Plus
Dere\GG13877-PA 521 GG13877-PA 164..518 64..429 1047 53 Plus
Dere\GG21716-PA 307 GG21716-PA 1..291 122..413 911 57.9 Plus
Dere\GG13315-PA 451 GG13315-PA 91..448 29..429 547 32.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19412-PA 432 GH19412-PA 1..432 1..434 2146 94 Plus
Dgri\GH16719-PA 542 GH16719-PA 184..539 64..429 1051 52.7 Plus
Dgri\GH10539-PA 640 GH10539-PA 416..605 51..240 606 57.4 Plus
Dgri\GH10541-PA 183 GH10541-PA 1..168 246..414 553 60.9 Plus
Dgri\GH16749-PA 451 GH16749-PA 91..448 29..429 523 31.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG6154-PD 434 CG6154-PD 1..434 1..434 2279 100 Plus
CG6154-PC 434 CG6154-PC 1..434 1..434 2279 100 Plus
CG42750-PC 1067 CG42750-PC 672..1051 35..413 1138 57.7 Plus
CG42750-PB 1068 CG42750-PB 673..1052 35..413 1138 57.7 Plus
CG44837-PC 801 CG44837-PC 434..790 54..417 1047 54.1 Plus
CG44837-PD 866 CG44837-PD 434..790 54..417 1047 54.1 Plus
CG44837-PB 964 CG44837-PB 597..953 54..417 1047 54.1 Plus
CG5282-PA 451 CG5282-PA 91..448 29..429 529 32.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22615-PA 436 GI22615-PA 1..436 1..434 2079 90 Plus
Dmoj\GI13799-PA 527 GI13799-PA 169..524 64..429 1040 52.5 Plus
Dmoj\GI20857-PA 646 GI20857-PA 455..646 51..242 609 57.3 Plus
Dmoj\GI20879-PA 183 GI20879-PA 1..167 246..413 550 61.3 Plus
Dmoj\GI13474-PA 451 GI13474-PA 108..448 46..429 542 32.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21839-PA 433 GL21839-PA 1..433 1..434 2271 97.5 Plus
Dper\GL19435-PA 298 GL19435-PA 34..294 4..240 580 47.5 Plus
Dper\GL19436-PA 443 GL19436-PA 251..427 236..413 578 60.1 Plus
Dper\GL11908-PA 451 GL11908-PA 108..448 46..429 541 32.3 Plus
Dper\GL25078-PA 314 GL25078-PA 255..314 64..124 166 45.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19396-PA 433 GA19396-PA 1..433 1..434 2271 97.5 Plus
Dpse\GA19227-PA 312 GA19227-PA 1..309 111..429 933 54.5 Plus
Dpse\GA20160-PA 328 GA20160-PA 1..312 122..413 888 54.3 Plus
Dpse\GA18784-PA 451 GA18784-PA 108..448 46..429 541 32.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10315-PA 404 GM10315-PA 1..399 1..399 2134 100 Plus
Dsec\GM24697-PA 521 GM24697-PA 164..518 64..429 1039 52.7 Plus
Dsec\GM17097-PA 183 GM17097-PA 1..168 246..414 556 62.1 Plus
Dsec\GM22218-PA 451 GM22218-PA 91..448 29..429 548 32.8 Plus
Dsec\GM17096-PA 551 GM17096-PA 18..135 123..240 338 53.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21276-PA 404 GD21276-PA 1..399 1..399 2127 99.7 Plus
Dsim\GD12767-PA 521 GD12767-PA 164..518 64..429 1045 53 Plus
Dsim\GD21841-PA 330 GD21841-PA 2..314 100..413 980 58.3 Plus
Dsim\GD12190-PA 451 GD12190-PA 91..448 29..429 549 32.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23861-PA 434 GJ23861-PA 1..434 1..434 2128 92.7 Plus
Dvir\GJ11668-PA 465 GJ11668-PA 107..462 64..429 1058 53 Plus
Dvir\GJ19849-PA 183 GJ19849-PA 1..168 246..414 552 61.5 Plus
Dvir\GJ11837-PA 459 GJ11837-PA 91..456 29..429 495 30.6 Plus
Dvir\GJ19848-PA 920 GJ19848-PA 130..247 123..240 341 53.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13967-PA 636 GK13967-PA 1..422 1..434 2193 93.5 Plus
Dwil\GK13640-PA 509 GK13640-PA 165..506 64..429 971 50.5 Plus
Dwil\GK14579-PA 705 GK14579-PA 475..686 51..240 574 52.4 Plus
Dwil\GK14581-PA 183 GK14581-PA 1..168 246..414 554 61.5 Plus
Dwil\GK17400-PA 451 GK17400-PA 108..448 46..429 553 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23663-PA 434 GE23663-PA 1..434 1..434 2315 99.3 Plus
Dyak\GE20168-PA 521 GE20168-PA 164..518 64..429 1047 53 Plus
Dyak\GE12740-PA 183 GE12740-PA 1..168 246..414 551 61.5 Plus
Dyak\GE22404-PA 451 GE22404-PA 91..448 29..429 548 32.8 Plus
Dyak\GE12739-PA 544 GE12739-PA 11..128 123..240 333 52.5 Plus

GH03296.hyp Sequence

Translation from 99 to 1403

> GH03296.hyp
MKSRKLPKGFVLCGLNCLTFVYFPLVLPILRCSAGAASSASGGGSKTADD
FDFRMQRVRNVLKEVPLIDGHNDLPWNIRKFLKNQLKDFHFGGDLRELAP
WSSSAWSHTDLRRLKEGMVSAQFWSAYAPCSSQHLDAVQLTLEQIDLIRR
LVQLYPHHMALVTTASGIEQTHRTGKIASLIGVEGGHAIGTSLSVLRMFY
QLGARYLTLTHTCNTPWADCCKVDEPGKYPHIGGLSQFGKLVVKEMNRLG
MIVDLSHVSVPTMLDALAASRAPLIFSHSSAHAICNSSRNVPDHVLQRIA
INGGLVMVAFYPHFVSCSGQATLHDVVAHINHIREVAGIDHVGIGAGYDG
VNLVPKGLEDVSKYPHLFAALLESDKWSEEDIAKLAGRNLIRVFKEVEAV
RDQMELLRVAPIDQSIPAEDIMGRSYCRYQGPRT*

GH03296.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG6154-PD 434 CG6154-PD 1..434 1..434 2279 100 Plus
CG6154-PC 434 CG6154-PC 1..434 1..434 2279 100 Plus
CG42750-PC 1067 CG42750-PC 672..1051 35..413 1138 57.7 Plus
CG42750-PB 1068 CG42750-PB 673..1052 35..413 1138 57.7 Plus
CG44837-PE 801 CG44837-PE 434..790 54..417 1047 54.1 Plus