Clone GH03388 Report

Search the DGRC for GH03388

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:33
Well:88
Vector:pOT2
Associated Gene/TranscriptHug-RA
Protein status:GH03388.pep: gold
Preliminary Size:2200
Sequenced Size:1035

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6371 2001-01-01 Release 2 assignment
CG6371 2001-07-04 Blastp of sequenced clone
CG6371 2003-01-01 Sim4 clustering to Release 3
hug 2008-04-29 Release 5.5 accounting
hug 2008-08-15 Release 5.9 accounting
hug 2008-12-18 5.12 accounting

Clone Sequence Records

GH03388.complete Sequence

1035 bp (1035 high quality bases) assembled on 2001-07-04

GenBank Submission: AY047528

> GH03388.complete
CAGTCCCAAAGCGCAACGCGGTTCCATTCGATCGTCCGACTATTAAGTTA
ATAGTTCCAGCGCTTCCGGAGTGTCCTGTCCTGTCCTGGGAGGTCAGTCG
CTCGTAAACGCCAGAAAACACCTAGCAGCGAACACAGTTGGCCCAGTTAT
GTGTGGTCCTAGTTATTGCACACTGCTGCTAATCGCGGCTTCCTGCTACA
TCCTTGTTTGCAGTCATGCGAAGTCCTTGCAGGGCACGAGCAAACTGGAT
TTGGGAAATCACATCAGCGCCGGCTCTGCCAGAGGATCATTATCACCAGC
TTCACCAGCGTTGAGCGAGGCACGTCAAAAGCGCGCCATGGGCGACTACA
AAGAGCTGACAGACATCATTGACGAGCTGGAGGAGAATAGCCTGGCCCAG
AAGGCCAGTGCCACCATGCAGGTGGCTGCCATGCCGCCGCAGGGCCAGGA
ATTCGATTTGGACACCATGCCGCCACTGACCTATTACCTGCTCCTTCAAA
AGCTACGACAGCTGCAGAGTAATGGGGAGCCCGCTTATCGCGTGCGGACG
CCACGCCTTGGCCGCAGCATTGACTCCTGGCGACTACTGGACGCGGAGGG
GGCGACGGGAATGGCGGGCGGCGAGGAGGCCATCGGCGGGCAGTTCATGC
AGCGCATGGTTAAGAAATCGGTGCCGTTCAAGCCACGCCTGGGCAAACGT
GCTCAAGTGTGCGGTGGCGATTGAGTCACGACAAGGGCGCGAGGACATGG
CACGGCACGGAATCGGACTGCGGATGGAGGACGGAGGACGAGCCCAGGAC
AAGGTTGAGGCCAGGCGACTGGCCCTTGAGTTAACATAACCAAGCCATAA
TGGCCAGCTGAATTCGACGCGACGCAAAAATAATCCACATATATGCATAG
TGAATGACTACTCTACTAGTTACTAGCGCTATAACCCTGATTTGAGAGGA
ACTAATGATGTGTATATACCGTACATATATTTATTATTTATTTAAATAAA
TTGTGTAGCCCCCAAAAAAAAAAAAAAAAAAAAAA

GH03388.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
hug-RA 1176 hug-RA 162..1176 1..1015 5075 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8353947..8354447 513..1013 2490 99.8 Plus
chr3R 27901430 chr3R 8353117..8353401 228..512 1425 100 Plus
chr3R 27901430 chr3R 8351576..8351808 1..233 1165 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:29:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12528576..12529080 513..1017 2525 100 Plus
3R 32079331 3R 12527746..12528030 228..512 1425 100 Plus
3R 32079331 3R 12526208..12526440 1..233 1165 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12269407..12269911 513..1017 2525 100 Plus
3R 31820162 3R 12268577..12268861 228..512 1425 100 Plus
3R 31820162 3R 12267039..12267271 1..233 1165 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:27:39 has no hits.

GH03388.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:28:38 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8351576..8351807 1..232 100 -> Plus
chr3R 8353122..8353401 233..512 100 -> Plus
chr3R 8353947..8354447 513..1013 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:10:32 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
hug-RA 1..576 149..724 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:29:46 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
hug-RA 1..576 149..724 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:45:28 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
hug-RA 1..576 149..724 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:03:12 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
hug-RA 1..576 149..724 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:46:23 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
Hug-RA 1..576 149..724 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:30:19 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
hug-RA 21..1033 1..1013 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:29:46 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
hug-RA 21..1033 1..1013 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:45:28 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
hug-RA 21..1033 1..1013 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:03:12 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
hug-RA 21..1033 1..1013 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:46:23 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
Hug-RA 21..1033 1..1013 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:38 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12527751..12528030 233..512 100 -> Plus
3R 12526208..12526439 1..232 100 -> Plus
3R 12528576..12529076 513..1013 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:38 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12527751..12528030 233..512 100 -> Plus
3R 12526208..12526439 1..232 100 -> Plus
3R 12528576..12529076 513..1013 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:38 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12527751..12528030 233..512 100 -> Plus
3R 12526208..12526439 1..232 100 -> Plus
3R 12528576..12529076 513..1013 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:45:28 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8351930..8352161 1..232 100 -> Plus
arm_3R 8353473..8353752 233..512 100 -> Plus
arm_3R 8354298..8354798 513..1013 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:41:14 Download gff for GH03388.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12268582..12268861 233..512 100 -> Plus
3R 12267039..12267270 1..232 100 -> Plus
3R 12269407..12269907 513..1013 100   Plus

GH03388.hyp Sequence

Translation from 148 to 723

> GH03388.hyp
MCGPSYCTLLLIAASCYILVCSHAKSLQGTSKLDLGNHISAGSARGSLSP
ASPALSEARQKRAMGDYKELTDIIDELEENSLAQKASATMQVAAMPPQGQ
EFDLDTMPPLTYYLLLQKLRQLQSNGEPAYRVRTPRLGRSIDSWRLLDAE
GATGMAGGEEAIGGQFMQRMVKKSVPFKPRLGKRAQVCGGD*

GH03388.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
Hug-PA 191 CG6371-PA 1..191 1..191 981 100 Plus

GH03388.pep Sequence

Translation from 148 to 723

> GH03388.pep
MCGPSYCTLLLIAASCYILVCSHAKSLQGTSKLDLGNHISAGSARGSLSP
ASPALSEARQKRAMGDYKELTDIIDELEENSLAQKASATMQVAAMPPQGQ
EFDLDTMPPLTYYLLLQKLRQLQSNGEPAYRVRTPRLGRSIDSWRLLDAE
GATGMAGGEEAIGGQFMQRMVKKSVPFKPRLGKRAQVCGGD*

GH03388.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23232-PA 218 GF23232-PA 1..215 1..190 678 70.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19060-PA 192 GG19060-PA 1..192 1..191 971 96.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18699-PA 182 GH18699-PA 5..180 5..190 526 69.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
Hug-PA 191 CG6371-PA 1..191 1..191 981 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24467-PA 183 GI24467-PA 5..179 5..189 517 61.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:51:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13916-PA 175 GL13916-PA 1..168 1..189 539 62.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:51:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19546-PA 193 GA19546-PA 1..186 1..189 616 74.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24044-PA 191 GM24044-PA 1..191 1..191 867 96.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18843-PA 191 GD18843-PA 1..191 1..191 986 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:51:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10559-PA 180 GJ10559-PA 5..178 5..190 529 67.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:51:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13719-PA 199 GK13719-PA 1..199 1..191 536 65.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:51:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26204-PA 191 GE26204-PA 1..191 1..191 982 97.4 Plus