BDGP Sequence Production Resources |
Search the DGRC for GH03388
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 33 |
Well: | 88 |
Vector: | pOT2 |
Associated Gene/Transcript | Hug-RA |
Protein status: | GH03388.pep: gold |
Preliminary Size: | 2200 |
Sequenced Size: | 1035 |
Gene | Date | Evidence |
---|---|---|
CG6371 | 2001-01-01 | Release 2 assignment |
CG6371 | 2001-07-04 | Blastp of sequenced clone |
CG6371 | 2003-01-01 | Sim4 clustering to Release 3 |
hug | 2008-04-29 | Release 5.5 accounting |
hug | 2008-08-15 | Release 5.9 accounting |
hug | 2008-12-18 | 5.12 accounting |
1035 bp (1035 high quality bases) assembled on 2001-07-04
GenBank Submission: AY047528
> GH03388.complete CAGTCCCAAAGCGCAACGCGGTTCCATTCGATCGTCCGACTATTAAGTTA ATAGTTCCAGCGCTTCCGGAGTGTCCTGTCCTGTCCTGGGAGGTCAGTCG CTCGTAAACGCCAGAAAACACCTAGCAGCGAACACAGTTGGCCCAGTTAT GTGTGGTCCTAGTTATTGCACACTGCTGCTAATCGCGGCTTCCTGCTACA TCCTTGTTTGCAGTCATGCGAAGTCCTTGCAGGGCACGAGCAAACTGGAT TTGGGAAATCACATCAGCGCCGGCTCTGCCAGAGGATCATTATCACCAGC TTCACCAGCGTTGAGCGAGGCACGTCAAAAGCGCGCCATGGGCGACTACA AAGAGCTGACAGACATCATTGACGAGCTGGAGGAGAATAGCCTGGCCCAG AAGGCCAGTGCCACCATGCAGGTGGCTGCCATGCCGCCGCAGGGCCAGGA ATTCGATTTGGACACCATGCCGCCACTGACCTATTACCTGCTCCTTCAAA AGCTACGACAGCTGCAGAGTAATGGGGAGCCCGCTTATCGCGTGCGGACG CCACGCCTTGGCCGCAGCATTGACTCCTGGCGACTACTGGACGCGGAGGG GGCGACGGGAATGGCGGGCGGCGAGGAGGCCATCGGCGGGCAGTTCATGC AGCGCATGGTTAAGAAATCGGTGCCGTTCAAGCCACGCCTGGGCAAACGT GCTCAAGTGTGCGGTGGCGATTGAGTCACGACAAGGGCGCGAGGACATGG CACGGCACGGAATCGGACTGCGGATGGAGGACGGAGGACGAGCCCAGGAC AAGGTTGAGGCCAGGCGACTGGCCCTTGAGTTAACATAACCAAGCCATAA TGGCCAGCTGAATTCGACGCGACGCAAAAATAATCCACATATATGCATAG TGAATGACTACTCTACTAGTTACTAGCGCTATAACCCTGATTTGAGAGGA ACTAATGATGTGTATATACCGTACATATATTTATTATTTATTTAAATAAA TTGTGTAGCCCCCAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
hug-RA | 1176 | hug-RA | 162..1176 | 1..1015 | 5075 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 8353947..8354447 | 513..1013 | 2490 | 99.8 | Plus |
chr3R | 27901430 | chr3R | 8353117..8353401 | 228..512 | 1425 | 100 | Plus |
chr3R | 27901430 | chr3R | 8351576..8351808 | 1..233 | 1165 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 12528576..12529080 | 513..1017 | 2525 | 100 | Plus |
3R | 32079331 | 3R | 12527746..12528030 | 228..512 | 1425 | 100 | Plus |
3R | 32079331 | 3R | 12526208..12526440 | 1..233 | 1165 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 12269407..12269911 | 513..1017 | 2525 | 100 | Plus |
3R | 31820162 | 3R | 12268577..12268861 | 228..512 | 1425 | 100 | Plus |
3R | 31820162 | 3R | 12267039..12267271 | 1..233 | 1165 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 8351576..8351807 | 1..232 | 100 | -> | Plus |
chr3R | 8353122..8353401 | 233..512 | 100 | -> | Plus |
chr3R | 8353947..8354447 | 513..1013 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
hug-RA | 1..576 | 149..724 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
hug-RA | 1..576 | 149..724 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
hug-RA | 1..576 | 149..724 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
hug-RA | 1..576 | 149..724 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Hug-RA | 1..576 | 149..724 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
hug-RA | 21..1033 | 1..1013 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
hug-RA | 21..1033 | 1..1013 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
hug-RA | 21..1033 | 1..1013 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
hug-RA | 21..1033 | 1..1013 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Hug-RA | 21..1033 | 1..1013 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12527751..12528030 | 233..512 | 100 | -> | Plus |
3R | 12526208..12526439 | 1..232 | 100 | -> | Plus |
3R | 12528576..12529076 | 513..1013 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12527751..12528030 | 233..512 | 100 | -> | Plus |
3R | 12526208..12526439 | 1..232 | 100 | -> | Plus |
3R | 12528576..12529076 | 513..1013 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12527751..12528030 | 233..512 | 100 | -> | Plus |
3R | 12526208..12526439 | 1..232 | 100 | -> | Plus |
3R | 12528576..12529076 | 513..1013 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 8351930..8352161 | 1..232 | 100 | -> | Plus |
arm_3R | 8353473..8353752 | 233..512 | 100 | -> | Plus |
arm_3R | 8354298..8354798 | 513..1013 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12268582..12268861 | 233..512 | 100 | -> | Plus |
3R | 12267039..12267270 | 1..232 | 100 | -> | Plus |
3R | 12269407..12269907 | 513..1013 | 100 | Plus |
Translation from 148 to 723
> GH03388.hyp MCGPSYCTLLLIAASCYILVCSHAKSLQGTSKLDLGNHISAGSARGSLSP ASPALSEARQKRAMGDYKELTDIIDELEENSLAQKASATMQVAAMPPQGQ EFDLDTMPPLTYYLLLQKLRQLQSNGEPAYRVRTPRLGRSIDSWRLLDAE GATGMAGGEEAIGGQFMQRMVKKSVPFKPRLGKRAQVCGGD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Hug-PA | 191 | CG6371-PA | 1..191 | 1..191 | 981 | 100 | Plus |
Translation from 148 to 723
> GH03388.pep MCGPSYCTLLLIAASCYILVCSHAKSLQGTSKLDLGNHISAGSARGSLSP ASPALSEARQKRAMGDYKELTDIIDELEENSLAQKASATMQVAAMPPQGQ EFDLDTMPPLTYYLLLQKLRQLQSNGEPAYRVRTPRLGRSIDSWRLLDAE GATGMAGGEEAIGGQFMQRMVKKSVPFKPRLGKRAQVCGGD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23232-PA | 218 | GF23232-PA | 1..215 | 1..190 | 678 | 70.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19060-PA | 192 | GG19060-PA | 1..192 | 1..191 | 971 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18699-PA | 182 | GH18699-PA | 5..180 | 5..190 | 526 | 69.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Hug-PA | 191 | CG6371-PA | 1..191 | 1..191 | 981 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24467-PA | 183 | GI24467-PA | 5..179 | 5..189 | 517 | 61.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13916-PA | 175 | GL13916-PA | 1..168 | 1..189 | 539 | 62.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19546-PA | 193 | GA19546-PA | 1..186 | 1..189 | 616 | 74.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24044-PA | 191 | GM24044-PA | 1..191 | 1..191 | 867 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18843-PA | 191 | GD18843-PA | 1..191 | 1..191 | 986 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10559-PA | 180 | GJ10559-PA | 5..178 | 5..190 | 529 | 67.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13719-PA | 199 | GK13719-PA | 1..199 | 1..191 | 536 | 65.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26204-PA | 191 | GE26204-PA | 1..191 | 1..191 | 982 | 97.4 | Plus |