Clone GH03475 Report

Search the DGRC for GH03475

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:34
Well:75
Vector:pOT2
Associated Gene/TranscriptCG4390-RA
Protein status:GH03475.pep: gold
Preliminary Size:1300
Sequenced Size:1022

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4390 2001-01-01 Release 2 assignment
CG4390 2002-05-15 Blastp of sequenced clone
CG4390 2003-01-01 Sim4 clustering to Release 3
CG4390 2008-04-29 Release 5.5 accounting
CG4390 2008-08-15 Release 5.9 accounting
CG4390 2008-12-18 5.12 accounting

Clone Sequence Records

GH03475.complete Sequence

1022 bp (1022 high quality bases) assembled on 2002-05-15

GenBank Submission: AY118729

> GH03475.complete
CACACTGTTTTCTTATCGCTTGTTATTTTTAGATCGTCAAAAAACAAAAC
ATGACGCTCGAACAGCTGTCCGCAAATAAGTGCTTCGAGGGCGAGCAACG
CGTGTATCGCCATCGCTCGGACACCTTGAAGTGCGACATGACCTTTGGCG
TCTTCCTGCCGCCGGCCGCTTTGGAGGGTAAACCGTGTCCGGTGCTGTTC
TTCCTCAGCGGACTGACCTGCACGCATGAGAACTTCATCCAGAAGAGCGG
ATTCCAGCAGCACGCCGCCCGCCACAACCTGATCGTCGTCAATCCGGACA
CTTCGCCCAGGGGCGTGGAAATTGCCGGCCAAGATGATGCATACGACTTT
GGAAGCGGGGCTGGATTCTATGTGGATGCAAAGGAGGAGCCGTGGTCGAA
GCACTACAAGATGTACAGCTATGTGACCCAGGAGCTGGTGGATGTGGTCA
ATGCCAATCTGCCCGTGGTTCCCGGTAAACGCGGTATATTCGGCCACAGT
ATGGGCGGCCACGGAGCCCTGATCTGCGCGCTTAAGAATCCCGGGCTGTA
CCAGTCGGTGTCCGCTTTTGCGCCGATTGCCAATCCCACCGAGTGCCCGT
GGGGCAAGAAGGCCTTTGCCGGCTATCTGGGCTCCAATCCGGATGACTGG
GCCCTGTGGGATGCCACGCATCTGGTGTCGCAGTACGAGAGCACTCCGCA
GGAGCTCTTCATCGACCAAGGTGCAGCAGACAACTTCCTGGCCGGCAAGC
AGCTGCTGCCGGAGAACCTGCTGGCTGCCGCAGATGGCAATGATCACATC
CAGACCATCTTCAAGCAGCGCGAGGGATACGATCACAGCTACTTCTACAT
CGCCACGTTCGTCGCCGAACACATCGCCTACCATGCCGCCCTGCTCACAG
CTTCCGCTTGATGATATTCCGCTTGTACATAATCGTTGGTTTCCACCGAA
ACCATAATTCAACGTAAATTTGGCAGTAAATAAACCAATTTCGACTGAGC
TTCTAAAAAAAAAAAAAAAAAA

GH03475.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG4390-RA 1124 CG4390-RA 73..1080 1..1008 5040 100 Plus
CG4390.a 1231 CG4390.a 201..1161 48..1008 4805 100 Plus
CG4390-RB 1207 CG4390-RB 209..1169 48..1008 4805 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:51:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15880361..15881317 1004..48 4650 99.1 Minus
chr3R 27901430 chr3R 15881385..15881432 47..1 190 97.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:29:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:51:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20056414..20057374 1008..48 4805 100 Minus
3R 32079331 3R 20057442..20057488 47..1 235 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19797245..19798205 1008..48 4805 100 Minus
3R 31820162 3R 19798273..19798319 47..1 235 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:51:56 has no hits.

GH03475.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:53:03 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15880361..15881317 48..1004 99 <- Minus
chr3R 15881385..15881432 1..47 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:10:40 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 130..993 48..911 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:54 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 130..993 48..911 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:09:56 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 130..993 48..911 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:44:30 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 130..993 48..911 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:43:32 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RB 130..993 48..911 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:29:53 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RA 28..1031 1..1004 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:54 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RA 28..1031 1..1004 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:09:56 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RA 28..1031 1..1004 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:44:30 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RA 28..1031 1..1004 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:43:32 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
CG4390-RA 3..1006 1..1004 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:53:03 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20056418..20057374 48..1004 100 <- Minus
3R 20057442..20057488 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:53:03 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20056418..20057374 48..1004 100 <- Minus
3R 20057442..20057488 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:53:03 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20056418..20057374 48..1004 100 <- Minus
3R 20057442..20057488 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:09:56 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15882140..15883096 48..1004 100 <- Minus
arm_3R 15883164..15883210 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:52 Download gff for GH03475.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19797249..19798205 48..1004 100 <- Minus
3R 19798273..19798319 1..47 100   Minus

GH03475.pep Sequence

Translation from 50 to 910

> GH03475.pep
MTLEQLSANKCFEGEQRVYRHRSDTLKCDMTFGVFLPPAALEGKPCPVLF
FLSGLTCTHENFIQKSGFQQHAARHNLIVVNPDTSPRGVEIAGQDDAYDF
GSGAGFYVDAKEEPWSKHYKMYSYVTQELVDVVNANLPVVPGKRGIFGHS
MGGHGALICALKNPGLYQSVSAFAPIANPTECPWGKKAFAGYLGSNPDDW
ALWDATHLVSQYESTPQELFIDQGAADNFLAGKQLLPENLLAAADGNDHI
QTIFKQREGYDHSYFYIATFVAEHIAYHAALLTASA*

GH03475.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17336-PA 327 GF17336-PA 44..327 1..285 1292 83.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15619-PA 330 GG15619-PA 45..330 1..286 1491 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23926-PA 285 GH23926-PA 1..285 1..284 1299 83.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG4390-PA 286 CG4390-PA 1..286 1..286 1541 100 Plus
CG4390-PB 330 CG4390-PB 45..330 1..286 1541 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10052-PA 285 GI10052-PA 1..285 1..284 1285 82.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12516-PA 338 GL12516-PA 51..336 1..285 1285 82.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27533-PA 338 GA27533-PA 51..336 1..285 1287 82.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17704-PA 328 GM17704-PA 45..328 1..284 1520 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20081-PA 328 GD20081-PA 45..328 1..284 1528 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23787-PA 285 GJ23787-PA 1..285 1..284 1249 80 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22793-PA 285 GK22793-PA 1..285 1..284 1324 83.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25088-PA 330 GE25088-PA 45..330 1..286 1501 96.9 Plus

GH03475.hyp Sequence

Translation from 50 to 910

> GH03475.hyp
MTLEQLSANKCFEGEQRVYRHRSDTLKCDMTFGVFLPPAALEGKPCPVLF
FLSGLTCTHENFIQKSGFQQHAARHNLIVVNPDTSPRGVEIAGQDDAYDF
GSGAGFYVDAKEEPWSKHYKMYSYVTQELVDVVNANLPVVPGKRGIFGHS
MGGHGALICALKNPGLYQSVSAFAPIANPTECPWGKKAFAGYLGSNPDDW
ALWDATHLVSQYESTPQELFIDQGAADNFLAGKQLLPENLLAAADGNDHI
QTIFKQREGYDHSYFYIATFVAEHIAYHAALLTASA*

GH03475.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG4390-PA 286 CG4390-PA 1..286 1..286 1541 100 Plus
CG4390-PB 330 CG4390-PB 45..330 1..286 1541 100 Plus