Clone GH03577 Report

Search the DGRC for GH03577

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:35
Well:77
Vector:pOT2
Associated Gene/Transcriptnopo-RA
Protein status:GH03577.pep: gold
Preliminary Size:1728
Sequenced Size:1539

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5140 2001-01-01 Release 2 assignment
CG5140 2001-10-10 Blastp of sequenced clone
CG5140 2003-01-01 Sim4 clustering to Release 3
nopo 2008-04-29 Release 5.5 accounting
nopo 2008-08-15 Release 5.9 accounting
nopo 2008-12-18 5.12 accounting

Clone Sequence Records

GH03577.complete Sequence

1539 bp (1539 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060610

> GH03577.complete
CAAACTGTTCGGCGTGCGTTTATTTGTTGTTCTTTTGTAATAACTATTTT
TATGTAGTTATTTGTGCCAAAAATGTTGAACTTAAACTGCGTGATATGCG
CCGAATTGTTTGGCCAGGCCGACGAGGTTTTTGCCACAGTTTGTGGTCAT
ATGTTCCACCACAACTGTCTAAATCAATGGCTCGATCGATCAAAGACCTG
TCCTCAGTGCCGGAATAAGTGCACTACCCGCAACATATTTAGGGTCTATT
TCAATCTGGCCAACTTGGATGTGAGCCACATCGATGTTGGTTCACTGCAG
GAGCAGCTGGACAATGCGATGTTGTCCATGAAAATGGTCGAAAAAGAGCG
CAACAAGGATGAACAGCAGATTCGGGATCTGAAGGAAACACAAAAGAAGT
GCCTCAAAACCATAGCCGGTTTGGAGCAGAAGGTGCAAAAGAAGGATTTT
CTCATCAGCAGCTATGTCGAGCAAATTGGCGTCCTCAAGAGTGATGCCCA
TGTCGTTGATGGGTTGCGCAAGGAAAACAAAACATTGAAATCACAGATCC
AGAGTATGGAAGGCATATCGGCTATTCTGGCGGCTGGCTCGGCGGATGCC
GACCGCTTGCTCAAGAACGAGGCTGATCCACATGTCCTAGCCAACTGGGT
GTCCACTCTCAAGAGGGAGTTGCGACAATGCGAGAGCAAAAAGACGGAGC
TCAGGAATGTAGTGAAGGTGGTGCAGAATGATCTGCGAAAGGAGATCGAA
CTAAAGCGCAAGCTGGAAGAGCGTGTTTCACACCTGGAGAGCGACCTTTA
CCAGGCGCAGGAGAAGCTACAAGCTTTTGAGAACAAGACCGCTTACTTGG
ACTCACCAAATGCCTCTTGTGGTCTGAACAGCAACATTTTGGCCCTTAAA
AGGGAGGAAAGGCGTACCACTATTTCCCCTACAGTTAAGGAGAATATTAA
GCGCATCGAAGAATCCACCTCCCCATATCTCAACATTAAATCCAGCAGCG
TCGGGTTGGCGCATCTTCTTAATACTAAGGGTAACATTGGGCTGGCCAAG
TCTAAAATATCGCCCATCAAGGGAGTCGGTGGCGGTGTGTCTATGACCAG
CGGAACCATACGGAAAACCAGCAGTGATCTCAGTGAAAAGTATTCAATCT
TCAAGAAGCCAAGACTGCTGCTGGGAAGTTCAAGTAGTTCTGCGTTGACG
GCCACGACGGGCTCAAATTTTGTCTACAATGGAATGGGCGGTTCTGAGAA
GGTTGACCCCTTTGCGCAGCGCGCCGAGGAAGAGGGTCTTTCCACAATCA
GATCCTCGACCGCCCTTTCCCGGAATGTCAACCAGCGTCTTAAAGCCGGC
TCGCTGCGCAACTTTAACCTGGGCAAATAAGTCCACAGCCATGTGATCAT
AAGAGACTGCCCCAGTTGGGTATTAGCACGCGATTGGTATTGAGGATTGC
CGATTTTGTTAGTTAGCCAATGCATGAATTAAGCAATAGTAATAATTTAG
CAGTAAATATATAAAAATACAAAAAAAAAAAAAAAAAAA

GH03577.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
nopo-RA 1719 nopo-RA 200..1719 1..1520 7600 100 Plus
nopo.a 1671 nopo.a 155..1671 1..1520 7530 99.8 Plus
CG5721-RA 1768 CG5721-RA 1641..1768 1524..1397 640 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14069273..14069654 1139..1520 1910 100 Plus
chr2R 21145070 chr2R 14068306..14068659 405..758 1770 100 Plus
chr2R 21145070 chr2R 14068031..14068247 188..404 1070 99.5 Plus
chr2R 21145070 chr2R 14069009..14069212 937..1140 1020 100 Plus
chr2R 21145070 chr2R 14067785..14067972 1..188 940 100 Plus
chr2R 21145070 chr2R 14068831..14068952 815..936 610 100 Plus
chr2R 21145070 chr2R 14068719..14068777 758..816 295 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:29:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18182138..18182523 1139..1524 1930 100 Plus
2R 25286936 2R 18181171..18181524 405..758 1770 100 Plus
2R 25286936 2R 18180896..18181112 188..404 1085 100 Plus
2R 25286936 2R 18181874..18182077 937..1140 1020 100 Plus
2R 25286936 2R 18180650..18180837 1..188 940 100 Plus
2R 25286936 2R 18181696..18181817 815..936 610 100 Plus
2R 25286936 2R 18181584..18181642 758..816 295 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18183337..18183722 1139..1524 1930 100 Plus
2R 25260384 2R 18182370..18182723 405..758 1770 100 Plus
2R 25260384 2R 18182095..18182311 188..404 1085 100 Plus
2R 25260384 2R 18183073..18183276 937..1140 1020 100 Plus
2R 25260384 2R 18181849..18182036 1..188 940 100 Plus
2R 25260384 2R 18182895..18183016 815..936 610 100 Plus
2R 25260384 2R 18182783..18182841 758..816 295 100 Plus
Blast to na_te.dros performed 2019-03-15 17:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 1985..2079 113..16 131 62.2 Minus

GH03577.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:26:06 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14067785..14067972 1..188 100 -> Plus
chr2R 14068032..14068247 189..404 99 -> Plus
chr2R 14068306..14068659 405..758 100 -> Plus
chr2R 14068720..14068777 759..816 100 -> Plus
chr2R 14068833..14068952 817..936 100 -> Plus
chr2R 14069009..14069212 937..1140 100 -> Plus
chr2R 14069275..14069654 1141..1520 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:11:00 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
nopo-RA 1..1308 73..1380 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:55:37 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
nopo-RA 1..1308 73..1380 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:35:24 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
nopo-RA 1..1308 73..1380 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:24:41 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
nopo-RA 1..1308 73..1380 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:36:56 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
nopo-RA 1..1308 73..1380 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:41:25 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
nopo-RA 155..1674 1..1520 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:55:37 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
nopo-RA 155..1674 1..1520 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:35:24 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
nopo-RA 34..1553 1..1520 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:24:41 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
nopo-RA 155..1674 1..1520 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:36:56 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
nopo-RA 34..1553 1..1520 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:26:06 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18180650..18180837 1..188 100 -> Plus
2R 18180897..18181112 189..404 100 -> Plus
2R 18181171..18181524 405..758 100 -> Plus
2R 18181585..18181642 759..816 100 -> Plus
2R 18181698..18181817 817..936 100 -> Plus
2R 18181874..18182077 937..1140 100 -> Plus
2R 18182140..18182519 1141..1520 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:26:06 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18180650..18180837 1..188 100 -> Plus
2R 18180897..18181112 189..404 100 -> Plus
2R 18181171..18181524 405..758 100 -> Plus
2R 18181585..18181642 759..816 100 -> Plus
2R 18181698..18181817 817..936 100 -> Plus
2R 18181874..18182077 937..1140 100 -> Plus
2R 18182140..18182519 1141..1520 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:26:06 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18180650..18180837 1..188 100 -> Plus
2R 18180897..18181112 189..404 100 -> Plus
2R 18181171..18181524 405..758 100 -> Plus
2R 18181585..18181642 759..816 100 -> Plus
2R 18181698..18181817 817..936 100 -> Plus
2R 18181874..18182077 937..1140 100 -> Plus
2R 18182140..18182519 1141..1520 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:35:24 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14068155..14068342 1..188 100 -> Plus
arm_2R 14068402..14068617 189..404 100 -> Plus
arm_2R 14068676..14069029 405..758 100 -> Plus
arm_2R 14069090..14069147 759..816 100 -> Plus
arm_2R 14069203..14069322 817..936 100 -> Plus
arm_2R 14069379..14069582 937..1140 100 -> Plus
arm_2R 14069645..14070024 1141..1520 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:01:55 Download gff for GH03577.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18182096..18182311 189..404 100 -> Plus
2R 18182370..18182723 405..758 100 -> Plus
2R 18182784..18182841 759..816 100 -> Plus
2R 18182897..18183016 817..936 100 -> Plus
2R 18183073..18183276 937..1140 100 -> Plus
2R 18183339..18183718 1141..1520 100   Plus
2R 18181849..18182036 1..188 100 -> Plus

GH03577.hyp Sequence

Translation from 72 to 1379

> GH03577.hyp
MLNLNCVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCRNKC
TTRNIFRVYFNLANLDVSHIDVGSLQEQLDNAMLSMKMVEKERNKDEQQI
RDLKETQKKCLKTIAGLEQKVQKKDFLISSYVEQIGVLKSDAHVVDGLRK
ENKTLKSQIQSMEGISAILAAGSADADRLLKNEADPHVLANWVSTLKREL
RQCESKKTELRNVVKVVQNDLRKEIELKRKLEERVSHLESDLYQAQEKLQ
AFENKTAYLDSPNASCGLNSNILALKREERRTTISPTVKENIKRIEESTS
PYLNIKSSSVGLAHLLNTKGNIGLAKSKISPIKGVGGGVSMTSGTIRKTS
SDLSEKYSIFKKPRLLLGSSSSSALTATTGSNFVYNGMGGSEKVDPFAQR
AEEEGLSTIRSSTALSRNVNQRLKAGSLRNFNLGK*

GH03577.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
nopo-PA 435 CG5140-PA 1..435 1..435 2196 100 Plus
nopo-PB 434 CG5140-PB 1..434 1..435 2179 99.8 Plus
CG10916-PB 263 CG10916-PB 28..90 2..63 195 52.4 Plus
CG10916-PA 263 CG10916-PA 28..90 2..63 195 52.4 Plus

GH03577.pep Sequence

Translation from 72 to 1379

> GH03577.pep
MLNLNCVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCRNKC
TTRNIFRVYFNLANLDVSHIDVGSLQEQLDNAMLSMKMVEKERNKDEQQI
RDLKETQKKCLKTIAGLEQKVQKKDFLISSYVEQIGVLKSDAHVVDGLRK
ENKTLKSQIQSMEGISAILAAGSADADRLLKNEADPHVLANWVSTLKREL
RQCESKKTELRNVVKVVQNDLRKEIELKRKLEERVSHLESDLYQAQEKLQ
AFENKTAYLDSPNASCGLNSNILALKREERRTTISPTVKENIKRIEESTS
PYLNIKSSSVGLAHLLNTKGNIGLAKSKISPIKGVGGGVSMTSGTIRKTS
SDLSEKYSIFKKPRLLLGSSSSSALTATTGSNFVYNGMGGSEKVDPFAQR
AEEEGLSTIRSSTALSRNVNQRLKAGSLRNFNLGK*

GH03577.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12143-PA 424 GF12143-PA 1..424 1..435 1762 77.7 Plus
Dana\GF12140-PA 263 GF12140-PA 27..163 2..139 192 30.3 Plus
Dana\GF12141-PA 258 GF12141-PA 23..85 2..63 165 44.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21854-PA 435 GG21854-PA 1..435 1..435 2113 92.9 Plus
Dere\GG21853-PA 263 GG21853-PA 28..89 2..62 195 50 Plus
Dere\GG20622-PA 269 GG20622-PA 24..87 2..65 163 47.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22143-PA 433 GH22143-PA 1..433 1..435 1579 69.6 Plus
Dgri\GH22142-PA 266 GH22142-PA 1..255 27..316 506 43.4 Plus
Dgri\GH20284-PA 246 GH20284-PA 16..78 2..63 179 47.6 Plus
Dgri\GH24407-PA 147 GH24407-PA 19..98 3..84 149 30.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
nopo-PA 435 CG5140-PA 1..435 1..435 2196 100 Plus
nopo-PB 434 CG5140-PB 1..434 1..435 2179 99.8 Plus
CG10916-PB 263 CG10916-PB 28..90 2..63 195 52.4 Plus
CG10916-PA 263 CG10916-PA 28..90 2..63 195 52.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19373-PA 429 GI19373-PA 1..429 1..435 1470 64.5 Plus
Dmoj\GI19455-PA 246 GI19455-PA 16..141 2..134 192 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17755-PA 432 GL17755-PA 1..432 1..435 1774 76.8 Plus
Dper\GL17754-PA 253 GL17754-PA 14..76 2..63 189 50.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18686-PA 431 GA18686-PA 1..431 1..435 1780 76.6 Plus
Dpse\GA10640-PA 253 GA10640-PA 14..76 2..63 189 50.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21854-PA 432 GM21854-PA 1..432 1..435 2154 93.6 Plus
Dsec\GM21853-PA 266 GM21853-PA 28..159 2..135 191 32.1 Plus
Dsec\GM18926-PA 151 GM18926-PA 5..65 3..65 145 39.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11347-PA 435 GD11347-PA 1..435 1..435 2132 95.4 Plus
Dsim\GD11346-PA 263 GD11346-PA 28..159 2..135 194 32.9 Plus
Dsim\GD24619-PA 151 GD24619-PA 5..65 3..65 145 39.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19929-PA 434 GJ19929-PA 1..434 1..435 1654 71.9 Plus
Dvir\GJ21206-PA 249 GJ21206-PA 19..81 2..63 176 46 Plus
Dvir\GJ16388-PA 146 GJ16388-PA 24..86 3..67 158 35.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22967-PA 429 GK22967-PA 1..429 1..435 1594 69.7 Plus
Dwil\GK22966-PA 266 GK22966-PA 32..93 2..63 197 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:59:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11933-PA 435 GE11933-PA 1..435 1..435 2144 94.5 Plus
Dyak\GE11932-PA 263 GE11932-PA 28..125 2..92 204 38.8 Plus
Dyak\GE11812-PA 269 GE11812-PA 24..88 2..65 170 43.1 Plus
Dyak\GE16987-PA 168 GE16987-PA 5..62 3..62 145 40 Plus