Clone GH03826 Report

Search the DGRC for GH03826

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:38
Well:26
Vector:pOT2
Associated Gene/TranscriptCG12744-RA
Protein status:GH03826.pep: gold
Preliminary Size:1300
Sequenced Size:889

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12744 2001-01-01 Release 2 assignment
CG12744 2002-06-13 Blastp of sequenced clone
CG12744 2003-01-01 Sim4 clustering to Release 3
CG12744 2008-04-29 Release 5.5 accounting
CG12744 2008-08-15 Release 5.9 accounting
CG12744 2008-12-18 5.12 accounting

Clone Sequence Records

GH03826.complete Sequence

889 bp (889 high quality bases) assembled on 2002-06-13

GenBank Submission: AY122089

> GH03826.complete
TGACTTTTAAGTGCGCATCGAATAGACTGGATGTTGAATGAAAAGAAAGA
CGTGTAAATAACGGAGTAAAAGAACGAGAGCGAGGAACCGTAATGCGAGT
AGTTCATATGTTGATGAATTGAAAATATAGAGAGTTTCCATTCGTATATT
CTTAAGCTAACATAAAAATAAACAAGTTGCATGTGAAATAAATAGATAAT
GGAAACGGCGTTGGCTGAAGTGCAACTTTCCTGTCTGCTGTGCGAGCAGA
CTTTTGATGCCACTGAGAAGCTGGACGAACACCTCCCCACCCACTTTCCG
CAGCCTGTGAGCACTGGTCAAACATGCGATATATGCGGGCGCACGATGCG
ATCCTCGCTGGAACTGCACCAGCACTATAAAAGATACCATGAAGCCCATG
TGCCCAACACAGAGGGACACTTTCAATGCCAGCTCTGCGACAAGGTATTC
CTCCTCCAGGATCATCTCAAGGTACACGTGAAGATTGAGCACGCGACCGA
TGGCTACCAACCAGATGAGAAGTCCTTAGATTGGCAGCACTACTCTCCCA
GAAGTCTAGACACAACAAACGATTATAAGCTGGATCCCATCTTGTGTCCT
CCACCAAAGAGGAAGTATCCGCCGCGCTCCCCCTTCTTCAATCCGAATCT
CTGGCTAGGCGCTGACAACTGTTTTATGTAGAGGAACATAGAACCAGGAT
ATGTCTTGCGAAGGGCTGACCGATTTATTGAGTCTTATGCGCCATCATCT
ATCCATTGTAAATGATTGTTAATTTAATTAAGGTCTTTCCCAAAACTAAA
TTGGGATATATTGGGAACAACAGATGTGCCTGTACATATGAAAATAAAAC
GCATTGCCTTATGATTTAATTAAAAAAAAAAAAAAAAAA

GH03826.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG12744-RA 1044 CG12744-RA 170..1044 1..875 4375 100 Plus
CG12744-RB 821 CG12744-RB 104..821 157..874 3590 100 Plus
CG12744.a 807 CG12744.a 129..807 196..874 3395 100 Plus
CG12744.a 807 CG12744.a 35..128 1..94 470 100 Plus
CG12744-RB 821 CG12744-RB 15..107 1..93 450 98.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5762799..5763453 1..645 3090 98.5 Plus
chr2R 21145070 chr2R 5763509..5763735 645..871 1120 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:30:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9875316..9875960 1..645 3225 100 Plus
2R 25286936 2R 9876016..9876246 645..875 1155 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9876515..9877159 1..645 3225 100 Plus
2R 25260384 2R 9877215..9877445 645..875 1155 100 Plus
Blast to na_te.dros performed 2019-03-16 12:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
Circe 7450 Circe CIRC 7450bp 1628..1682 223..170 110 69.1 Minus

GH03826.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:46:20 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5763509..5763735 645..871 99   Plus
chr2R 5762799..5763452 1..644 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:11:37 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
CG12744-RB 1..483 199..681 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:54:10 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
CG12744-RB 1..483 199..681 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:22:09 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
CG12744-RA 1..483 199..681 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:45:14 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
CG12744-RB 1..483 199..681 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:54:36 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
CG12744-RA 1..483 199..681 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:09:00 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
CG12744-RA 33..903 1..871 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:54:10 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
CG12744-RA 33..903 1..871 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:22:09 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
CG12744-RA 36..906 1..871 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:45:14 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
CG12744-RA 33..903 1..871 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:54:36 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
CG12744-RA 36..906 1..871 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:46:20 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9875316..9875959 1..644 100 -> Plus
2R 9876016..9876242 645..871 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:46:20 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9875316..9875959 1..644 100 -> Plus
2R 9876016..9876242 645..871 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:46:20 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9875316..9875959 1..644 100 -> Plus
2R 9876016..9876242 645..871 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:22:09 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5762821..5763464 1..644 100 -> Plus
arm_2R 5763521..5763747 645..871 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:16:12 Download gff for GH03826.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9877215..9877441 645..871 100   Plus
2R 9876515..9877158 1..644 100 -> Plus

GH03826.hyp Sequence

Translation from 198 to 680

> GH03826.hyp
METALAEVQLSCLLCEQTFDATEKLDEHLPTHFPQPVSTGQTCDICGRTM
RSSLELHQHYKRYHEAHVPNTEGHFQCQLCDKVFLLQDHLKVHVKIEHAT
DGYQPDEKSLDWQHYSPRSLDTTNDYKLDPILCPPPKRKYPPRSPFFNPN
LWLGADNCFM*

GH03826.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG12744-PB 160 CG12744-PB 1..160 1..160 905 100 Plus
CG12744-PA 160 CG12744-PA 1..160 1..160 905 100 Plus

GH03826.pep Sequence

Translation from 198 to 680

> GH03826.pep
METALAEVQLSCLLCEQTFDATEKLDEHLPTHFPQPVSTGQTCDICGRTM
RSSLELHQHYKRYHEAHVPNTEGHFQCQLCDKVFLLQDHLKVHVKIEHAT
DGYQPDEKSLDWQHYSPRSLDTTNDYKLDPILCPPPKRKYPPRSPFFNPN
LWLGADNCFM*

GH03826.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24115-PA 160 GG24115-PA 1..160 1..160 717 90.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG12744-PB 160 CG12744-PB 1..160 1..160 905 100 Plus
CG12744-PA 160 CG12744-PA 1..160 1..160 905 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19159-PA 146 GI19159-PA 13..146 10..149 180 31.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20631-PA 152 GL20631-PA 9..146 2..151 227 36.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11784-PA 152 GA11784-PA 9..146 2..151 227 36.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21163-PA 160 GM21163-PA 1..160 1..160 762 94.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10694-PA 160 GD10694-PA 1..160 1..160 759 93.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22294-PA 168 GJ22294-PA 14..161 5..156 275 39.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19312-PA 160 GE19312-PA 1..160 1..160 697 86.9 Plus