Clone GH03839 Report

Search the DGRC for GH03839

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:38
Well:39
Vector:pOT2
Associated Gene/TranscriptKaz1-ORFB-RA
Protein status:GH03839.pep: gold
Preliminary Size:686
Sequenced Size:561

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33045 2001-11-29 Blastp of sequenced clone
CG1220 2002-01-01 Sim4 clustering to Release 2
CG33045 2003-01-01 Sim4 clustering to Release 3
Kaz1-ORFB 2008-04-29 Release 5.5 accounting
Kaz1-ORFB 2008-08-15 Release 5.9 accounting
Kaz1-ORFB 2008-12-18 5.12 accounting

Clone Sequence Records

GH03839.complete Sequence

561 bp (561 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069042

> GH03839.complete
CTCAAGCGAAGCGGAACCAACAAACTCCCGAAATGGATTGGATCAAAATA
TTTGTTTCAGGTCTTGCCCTGCTATTGATTGGGATGGCGCAGTGCTACCC
GCAGTTCGATAGCGAAAACCCCTGGTTGAGGCCTCGGCAACCCACTGAAC
CTACGATATCTCCGAATGCGGGGGGCAGTACCCCGGCCAACGCTGCTCCA
CCAACCACCCAGTCACCGCGCTATTTCGCCTGTTTCCATTCATGCCCGGC
CACCAGCGAGTACAATCCAATCTGCGGCAGTGATAACGTGAACTACTACA
ATGAAAACAAGTTCAACTGCGCCTTGAACTGCGGCCTAAACATCCGGAAG
GTGCACAAGGGAATTTGTCAGACTTAGTCTAGATCGCTTGAATTCAGTTC
ACTTGTGTATGTAAGCATGAACGTATTGCAAATACTCTATTCATCGTCTG
ATCGATGACATCAGCGAATATAAATATGTATATATGTACGTACATAAATA
AAAACTTAGCGCTGTTACTGGTATATGGACGGTGTATGACCCCAAAAAAA
AAAAAAAAAAA

GH03839.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
Kaz1-ORFB-RC 910 Kaz1-ORFB-RC 408..903 54..549 2480 100 Plus
Kaz1-ORFA-RA 1938 Kaz1-ORFA-RA 1357..1642 54..339 1430 100 Plus
Kaz1-ORFB-RG 1938 Kaz1-ORFB-RG 1357..1642 54..339 1430 100 Plus
Kaz1-ORFA-RA 1938 Kaz1-ORFA-RA 1722..1931 340..549 1050 100 Plus
Kaz1-ORFB-RG 1938 Kaz1-ORFB-RG 1722..1931 340..549 1050 100 Plus
Kaz1-ORFB-RC 910 Kaz1-ORFB-RC 307..360 1..54 270 100 Plus
Kaz1-ORFA-RA 1938 Kaz1-ORFA-RA 1256..1309 1..54 270 100 Plus
Kaz1-ORFB-RG 1938 Kaz1-ORFB-RG 1256..1309 1..54 270 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 217445..217730 54..339 1430 100 Plus
chr3L 24539361 chr3L 217810..218013 340..543 1020 100 Plus
chr3L 24539361 chr3L 217344..217397 1..54 270 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:30:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:34:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 217490..217775 54..339 1430 100 Plus
3L 28110227 3L 217855..218064 340..549 1050 100 Plus
3L 28110227 3L 217389..217442 1..54 270 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 217490..217775 54..339 1430 100 Plus
3L 28103327 3L 217855..218064 340..549 1050 100 Plus
3L 28103327 3L 217389..217442 1..54 270 100 Plus
Blast to na_te.dros performed 2019-03-15 15:34:20
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 2685..2769 471..388 107 63.2 Minus

GH03839.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:35:27 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 217344..217397 1..54 100 -> Plus
chr3L 217446..217730 55..339 100 -> Plus
chr3L 217810..218013 340..543 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:11:40 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
Kaz1-ORFB-RF 1..345 33..377 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:24:27 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
Kaz1-ORFB-RF 1..345 33..377 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:32:28 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
Kaz1-ORFB-RA 1..345 33..377 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:51:21 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
Kaz1-ORFB-RF 1..345 33..377 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:09:40 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
Kaz1-ORFB-RA 1..345 33..377 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:59:57 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
Kaz1-ORFB-RC 307..360 1..54 100 -> Plus
Kaz1-ORFB-RC 409..897 55..543 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:24:27 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
Kaz1-ORFB-RF 588..1130 1..543 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:32:28 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
Kaz1-ORFB-RA 20..562 1..543 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:51:22 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
Kaz1-ORFB-RE 581..1123 1..543 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:09:40 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
Kaz1-ORFB-RA 20..562 1..543 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:27 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
3L 217491..217775 55..339 100 -> Plus
3L 217855..218058 340..543 100   Plus
3L 217389..217442 1..54 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:27 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
3L 217491..217775 55..339 100 -> Plus
3L 217855..218058 340..543 100   Plus
3L 217389..217442 1..54 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:27 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
3L 217491..217775 55..339 100 -> Plus
3L 217855..218058 340..543 100   Plus
3L 217389..217442 1..54 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:32:28 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 217389..217442 1..54 100 -> Plus
arm_3L 217491..217775 55..339 100 -> Plus
arm_3L 217855..218058 340..543 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:27:38 Download gff for GH03839.complete
Subject Subject Range Query Range Percent Splice Strand
3L 217491..217775 55..339 100 -> Plus
3L 217855..218058 340..543 100   Plus
3L 217389..217442 1..54 100 -> Plus

GH03839.hyp Sequence

Translation from 2 to 376

> GH03839.hyp
QAKRNQQTPEMDWIKIFVSGLALLLIGMAQCYPQFDSENPWLRPRQPTEP
TISPNAGGSTPANAAPPTTQSPRYFACFHSCPATSEYNPICGSDNVNYYN
ENKFNCALNCGLNIRKVHKGICQT*

GH03839.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
Kaz1-ORFB-PF 114 CG1220-PF 1..114 11..124 642 100 Plus
Kaz1-ORFB-PE 114 CG1220-PE 1..114 11..124 642 100 Plus
Kaz1-ORFB-PA 114 CG1220-PA 1..114 11..124 642 100 Plus
Kaz1-ORFB-PH 115 CG1220-PH 1..103 11..113 577 99 Plus
CG34454-PA 133 CG34454-PA 3..125 11..123 194 38.9 Plus

GH03839.pep Sequence

Translation from 32 to 376

> GH03839.pep
MDWIKIFVSGLALLLIGMAQCYPQFDSENPWLRPRQPTEPTISPNAGGST
PANAAPPTTQSPRYFACFHSCPATSEYNPICGSDNVNYYNENKFNCALNC
GLNIRKVHKGICQT*

GH03839.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24746-PA 119 GF24746-PA 10..119 11..112 231 52.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14702-PA 112 GG14702-PA 1..112 1..112 374 75 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13148-PA 166 GH13148-PA 29..67 63..101 174 76.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
Kaz1-ORFB-PF 114 CG1220-PF 1..114 1..114 642 100 Plus
Kaz1-ORFB-PE 114 CG1220-PE 1..114 1..114 642 100 Plus
Kaz1-ORFB-PA 114 CG1220-PA 1..114 1..114 642 100 Plus
Kaz1-ORFB-PH 115 CG1220-PH 1..103 1..103 577 99 Plus
CG34454-PA 133 CG34454-PA 3..125 1..113 194 38.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17786-PA 108 GI17786-PA 1..107 1..114 257 47.9 Plus
Dmoj\GI17274-PA 133 GI17274-PA 36..125 34..113 165 44.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16115-PA 109 GL16115-PA 1..107 1..113 250 52.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17247-PA 109 GA17247-PA 1..107 1..113 250 52.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14318-PA 114 GM14318-PA 1..114 1..114 572 93.9 Plus
Dsec\GM14292-PA 424 GM14292-PA 156..270 1..104 169 42.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13556-PA 114 GD13556-PA 1..114 1..114 578 94.7 Plus
Dsim\GD13530-PA 426 GD13530-PA 156..270 1..104 159 40.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17612-PA 59 GJ17612-PA 1..58 57..114 234 70.7 Plus
Dvir\GJ22810-PA 247 GJ22810-PA 58..114 44..101 139 54.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11275-PA 280 GK11275-PA 191..276 24..101 143 44.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21065-PA 112 GE21065-PA 1..112 1..112 464 78.6 Plus
Dyak\GE18022-PA 121 GE18022-PA 9..74 7..102 157 38.5 Plus
Dyak\GE21037-PA 433 GE21037-PA 219..274 47..104 149 53.4 Plus