Clone GH03980 Report

Search the DGRC for GH03980

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:39
Well:80
Vector:pOT2
Associated Gene/TranscriptHf-RA
Protein status:GH03980.pep: gold
Preliminary Size:1300
Sequenced Size:905

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10658 2001-01-01 Release 2 assignment
CG10658 2002-05-30 Blastp of sequenced clone
CG10658 2003-01-01 Sim4 clustering to Release 3
Hf 2008-04-29 Release 5.5 accounting
Hf 2008-08-15 Release 5.9 accounting
Hf 2008-12-18 5.12 accounting

Clone Sequence Records

GH03980.complete Sequence

905 bp (905 high quality bases) assembled on 2002-05-30

GenBank Submission: AY118294

> GH03980.complete
CAGCGATCAGAGGAGCATGGCGAGATCAGGGCGCAGTTCGAGGTTTCTTA
TCGGCGGCAGCACTTGCTGTTCGATGCTTCTGGGTCTTATCTGTCTGGCT
CTGGCGGACTCATCCCAAGTGAAAGAACGCAGCCCTACCATCTTGGTGAG
AAATACAATTCAAGCGGTGGAGAGGCTCTTCAATCAGGTGCTCTACACGA
CCATCGAAGATGCCCGCCAACGACTACCGGGTCTTCCGGCCAACGAAACC
ATCGATCGGCAGTACTTCGAGGAGCTCGACCTGGTTGCTGGGAACGAGGA
CTATTACAGCACTGCATTCTATATCTTCGCCTGGATAAACAGCGACCTCA
TGTACCATAAGACTCCCGATAAGTTGCTCGTCGAGGTTCTTCCCGGCGAG
AAGATCGCCATCCGCAGATTCTTCGCCAAGGTCAAGCCGCATCTTACCAA
GTATCTGCGACTCAGTCGACAGGACAGGTCGGAATTGGTTTCCAACGTCA
CCCAGTTGGCCACCGAAACCAAGGACAGTCTGATCACAACCTTCTTGGAG
TTTCCCCAGAACCTGAAGAGCCAACTTCCTGAGCTCCAGCTAATGGACTA
CACCAAATTGGCTCAGGCTTTGGTGCAGGGGGTGGCCAGTGGTATATGGA
CGAAGGCTTAAGATTAATAGCTAAATATTTAAACAATATCATAGAATTAG
AAAGTGTTTGTAATAAAATGAGAAATGTACTTCAAAGAACAATATTCGGA
ATCTATTTATACGAGGACTTTATTCCTGAAAAATGCCGTTTAACTTCCGG
AAAATTTCCGACTGTCTGATCAACATGTGTAGATATCGAGAACTGATACT
TTAAAGCAATAAAGATATTATCGTGACTTGGAAAAAAAAAAAAAAAAAAA
AAAAA

GH03980.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:57:48
Subject Length Description Subject Range Query Range Score Percent Strand
Hf-RA 895 Hf-RA 14..895 1..882 4410 100 Plus
CG18806.a 1527 CG18806.a 1..416 468..883 2080 100 Plus
CG18806-RA 1586 CG18806-RA 1..416 468..883 2080 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19965077..19965861 881..97 3820 99.1 Minus
chr2L 23010047 chr2L 19965923..19966020 98..1 490 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:30:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19966725..19967511 883..97 3935 100 Minus
2L 23513712 2L 19967573..19967670 98..1 490 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19966725..19967511 883..97 3935 100 Minus
2L 23513712 2L 19967573..19967670 98..1 490 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:59:08 has no hits.

GH03980.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:59:46 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19965077..19965860 98..881 99 <- Minus
chr2L 19965924..19966020 1..97 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:12:04 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
Hf-RA 1..645 17..661 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:36:52 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
Hf-RA 1..645 17..661 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:04:28 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
Hf-RA 1..645 17..661 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:28:31 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
Hf-RA 1..645 17..661 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:08:33 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
Hf-RA 1..645 17..661 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:09:08 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
Hf-RA 1..878 4..881 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:36:52 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
Hf-RA 14..894 1..881 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:04:28 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
Hf-RA 16..896 1..881 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:28:31 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
Hf-RA 1..878 4..881 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:08:33 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
Hf-RA 16..896 1..881 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:46 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19966727..19967510 98..881 100 <- Minus
2L 19967574..19967670 1..97 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:46 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19966727..19967510 98..881 100 <- Minus
2L 19967574..19967670 1..97 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:59:46 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19966727..19967510 98..881 100 <- Minus
2L 19967574..19967670 1..97 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:04:28 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19966727..19967510 98..881 100 <- Minus
arm_2L 19967574..19967670 1..97 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:01:02 Download gff for GH03980.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19966727..19967510 98..881 100 <- Minus
2L 19967574..19967670 1..97 100   Minus

GH03980.hyp Sequence

Translation from 1 to 660

> GH03980.hyp
SDQRSMARSGRSSRFLIGGSTCCSMLLGLICLALADSSQVKERSPTILVR
NTIQAVERLFNQVLYTTIEDARQRLPGLPANETIDRQYFEELDLVAGNED
YYSTAFYIFAWINSDLMYHKTPDKLLVEVLPGEKIAIRRFFAKVKPHLTK
YLRLSRQDRSELVSNVTQLATETKDSLITTFLEFPQNLKSQLPELQLMDY
TKLAQALVQGVASGIWTKA*

GH03980.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
Hf-PA 214 CG10658-PA 1..214 6..219 1081 100 Plus

GH03980.pep Sequence

Translation from 16 to 660

> GH03980.pep
MARSGRSSRFLIGGSTCCSMLLGLICLALADSSQVKERSPTILVRNTIQA
VERLFNQVLYTTIEDARQRLPGLPANETIDRQYFEELDLVAGNEDYYSTA
FYIFAWINSDLMYHKTPDKLLVEVLPGEKIAIRRFFAKVKPHLTKYLRLS
RQDRSELVSNVTQLATETKDSLITTFLEFPQNLKSQLPELQLMDYTKLAQ
ALVQGVASGIWTKA*

GH03980.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15467-PA 209 GF15467-PA 22..208 25..212 601 60.1 Plus
Dana\GF15466-PA 202 GF15466-PA 34..199 45..212 408 45.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21600-PA 216 GG21600-PA 1..213 1..214 979 86 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13035-PA 192 GH13035-PA 14..189 23..210 454 47.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:48
Subject Length Description Subject Range Query Range Score Percent Strand
Hf-PA 214 CG10658-PA 1..214 1..214 1081 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18184-PA 208 GI18184-PA 1..188 12..210 294 37.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26684-PA 207 GL26684-PA 1..204 1..211 668 61.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10473-PA 207 GA10473-PA 1..204 1..211 666 61.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16974-PA 214 GM16974-PA 1..213 1..213 1092 96.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Hf-PA 214 GD21724-PA 1..214 1..214 1094 96.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14654-PA 204 GJ14654-PA 1..198 12..210 461 46.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15207-PA 207 GK15207-PA 14..205 22..211 609 60.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Hf-PA 216 GE12617-PA 1..213 1..214 1017 89.7 Plus