Clone GH04071 Report

Search the DGRC for GH04071

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:40
Well:71
Vector:pOT2
Associated Gene/TranscriptmtTFB2-RA
Protein status:GH04071.pep: gold
Preliminary Size:1640
Sequenced Size:1506

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3910 2001-01-01 Release 2 assignment
CG3910 2001-10-10 Blastp of sequenced clone
CG3910 2003-01-01 Sim4 clustering to Release 3
mtTFB2 2008-04-29 Release 5.5 accounting
mtTFB2 2008-08-15 Release 5.9 accounting
mtTFB2 2008-12-18 5.12 accounting

Clone Sequence Records

GH04071.complete Sequence

1506 bp (1506 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060616

> GH04071.complete
CAATACACAGCTGATGCTTGTAAACAAACGAAAAGTTCACTTAATTTTCA
ATTTGTTAAAAATCTTAAGAAATGCTGCCCCTGCGATGCAGTTGGTCCTT
TGCCCGGGCCAACTATAGCACCAAAAAGGAACTGGTGACTCGCTACAGCG
GCGATTTCCCCGAGAAACTGCTCAACCGGAAGCAAAAGGTTCCCACTCAC
ATGTACATTGCAAATTCGGAGGCTGCTGCAAGGATTAACCAGTACCTGGA
GCCCCATTTCCAGAGCTCCGGTTGCGATACCGTGATGGAACTCAATTCCG
GTGCTGGGTACTTTACCCGGCATCTGTTGGACAGGGAATCCCAGTTTCGA
CGCATAATTCTGCTTGAGAGCATGGATCACTTTATGCCCAAAATCCAGGA
GCTACACACGCTATATCCGGAACGTGTGAAGGTGCGCCAAGGAGACTTTG
TGAACCTGTGGAAGTTGGTGTACATGGACAAAATGGACGGTGGTTCCAGG
GTGGCGGATCTCCTGAGTGATGTGCCCCAGAAAGCGTTTACAGATGATAT
CAACATGCTAGTCTTCGGCGCCGTGGGCTCCTATCCATTCTTCAAGCACT
TGATCAACTCCCTCATTTTTCAGACCAGCCTTTTCAACCTTGGACGCTGT
GAGATGATCCTCGCCATGCCGCCACCCATATACATACATCTCACCTGCAA
CAACGAGATTGGCTACCTCATTTACCGATCGACCAGCGTACTGTTTCAAA
TTCTGTTTGAGCACAAATTCATAGCCAAGGTGCCGCGCGAGGATTTTCTA
CCTCAGCAGATGGCCTATAGCCCCACCAAGAGTAGCAAGTTGGGTAAGGT
GCAGTCCATCAATCCCGAGTACTTGTACTTGGTGAAATTCACTCCGCGCC
GCAATCTTCATGAGCTGTGCCAGTCGCAGGATCTACCCGCTCTCTGGTTC
TTCATTAAGCAGAACTATGTAAGCCGACGAAACAGAATAATACCCAATTT
AGAAAAGTGGGTTCCCGGCTGTGGACCTCGGCTTATCATTAATCCGAAGT
CCTCCGAGTCCGTAACACCCATCTATCCAGATGAATTGCCCAAGAAACTA
CCACAGTACTCGTGCCAGAGTACTACAATGAGCACCAGAAACTACTATCC
CGGCATCAACATCTACACACAGTTCGGAGATCTCCTGCCCAGTCAGATTC
TGACGCTATTTAGTCAGTTTCGTCAGTGGCCGGAGTACGGCGAGAGCTCT
TTCCTCGCCTCGCTGGAAAATGCGCTGCTCAAGCTGGAGACTGCCAATGA
CGAACCAAACCTAGAGGATGGCGTCACGTTGCCAGAAGAGGATGATGCCG
AAGCAGATGAAATTATCGAAGAAGAAAGCCCTGTACCCGCCACCACTCCC
GTCAAGAGGCGCAGGAAAGCCAGTTCTTAGTTGTACATAATAGCGTTTTG
CTTGTGCAAGAAAAATAAAGAATTGCCTTCATTTTGAGAAAAAAAAAAAA
AAAAAA

GH04071.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
mtTFB2-RA 1543 mtTFB2-RA 39..1529 1..1491 7455 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5871367..5871912 1..546 2730 100 Plus
chr3R 27901430 chr3R 5872545..5873029 1004..1488 2425 100 Plus
chr3R 27901430 chr3R 5872167..5872483 687..1003 1585 100 Plus
chr3R 27901430 chr3R 5871965..5872105 546..686 705 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:30:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10045598..10046143 1..546 2730 100 Plus
3R 32079331 3R 10046776..10047263 1004..1491 2440 100 Plus
3R 32079331 3R 10046398..10046714 687..1003 1585 100 Plus
3R 32079331 3R 10046196..10046336 546..686 705 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9786429..9786974 1..546 2730 100 Plus
3R 31820162 3R 9787607..9788094 1004..1491 2440 100 Plus
3R 31820162 3R 9787229..9787545 687..1003 1585 100 Plus
3R 31820162 3R 9787027..9787167 546..686 705 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:38:53 has no hits.

GH04071.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:39:37 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5871367..5871912 1..546 100 -> Plus
chr3R 5871966..5872105 547..686 100 -> Plus
chr3R 5872167..5872483 687..1003 100 -> Plus
chr3R 5872545..5873029 1004..1488 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:12:53 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
mtTFB2-RA 1..1359 72..1430 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:55:28 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
mtTFB2-RA 1..1359 72..1430 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:35:11 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
mtTFB2-RA 1..1359 72..1430 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:24:31 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
mtTFB2-RA 1..1359 72..1430 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:11:50 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
mtTFB2-RA 1..1359 72..1430 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:41:13 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
mtTFB2-RA 23..1510 1..1488 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:55:28 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
mtTFB2-RA 23..1510 1..1488 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:35:11 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
mtTFB2-RA 25..1512 1..1488 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:24:31 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
mtTFB2-RA 23..1510 1..1488 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:11:50 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
mtTFB2-RA 25..1512 1..1488 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:37 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10045598..10046143 1..546 100 -> Plus
3R 10046197..10046336 547..686 100 -> Plus
3R 10046398..10046714 687..1003 100 -> Plus
3R 10046776..10047260 1004..1488 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:37 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10045598..10046143 1..546 100 -> Plus
3R 10046197..10046336 547..686 100 -> Plus
3R 10046398..10046714 687..1003 100 -> Plus
3R 10046776..10047260 1004..1488 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:37 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10045598..10046143 1..546 100 -> Plus
3R 10046197..10046336 547..686 100 -> Plus
3R 10046398..10046714 687..1003 100 -> Plus
3R 10046776..10047260 1004..1488 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:35:11 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5871320..5871865 1..546 100 -> Plus
arm_3R 5871919..5872058 547..686 100 -> Plus
arm_3R 5872120..5872436 687..1003 100 -> Plus
arm_3R 5872498..5872982 1004..1488 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:01:44 Download gff for GH04071.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9786429..9786974 1..546 100 -> Plus
3R 9787028..9787167 547..686 100 -> Plus
3R 9787229..9787545 687..1003 100 -> Plus
3R 9787607..9788091 1004..1488 100   Plus

GH04071.pep Sequence

Translation from 71 to 1429

> GH04071.pep
MLPLRCSWSFARANYSTKKELVTRYSGDFPEKLLNRKQKVPTHMYIANSE
AAARINQYLEPHFQSSGCDTVMELNSGAGYFTRHLLDRESQFRRIILLES
MDHFMPKIQELHTLYPERVKVRQGDFVNLWKLVYMDKMDGGSRVADLLSD
VPQKAFTDDINMLVFGAVGSYPFFKHLINSLIFQTSLFNLGRCEMILAMP
PPIYIHLTCNNEIGYLIYRSTSVLFQILFEHKFIAKVPREDFLPQQMAYS
PTKSSKLGKVQSINPEYLYLVKFTPRRNLHELCQSQDLPALWFFIKQNYV
SRRNRIIPNLEKWVPGCGPRLIINPKSSESVTPIYPDELPKKLPQYSCQS
TTMSTRNYYPGINIYTQFGDLLPSQILTLFSQFRQWPEYGESSFLASLEN
ALLKLETANDEPNLEDGVTLPEEDDAEADEIIEEESPVPATTPVKRRRKA
SS*

GH04071.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17852-PA 454 GF17852-PA 1..454 1..452 2004 83.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17302-PA 454 GG17302-PA 1..454 1..452 2274 93 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22567-PA 473 GH22567-PA 2..469 1..450 1746 67.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
mtTFB2-PA 452 CG3910-PA 1..452 1..452 2381 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23134-PA 471 GI23134-PA 19..469 4..452 1760 71.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27200-PA 452 GL27200-PA 1..446 1..442 1899 77.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17767-PA 452 GA17767-PA 1..446 1..442 1900 77.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23852-PA 454 GM23852-PA 1..454 1..452 2239 95.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18660-PA 457 GD18660-PA 1..452 1..450 2222 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10435-PA 471 GJ10435-PA 1..469 1..452 1756 69.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22500-PA 439 GK22500-PA 22..430 25..433 1727 76.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26003-PA 454 GE26003-PA 1..454 1..452 2304 93.6 Plus

GH04071.hyp Sequence

Translation from 71 to 1429

> GH04071.hyp
MLPLRCSWSFARANYSTKKELVTRYSGDFPEKLLNRKQKVPTHMYIANSE
AAARINQYLEPHFQSSGCDTVMELNSGAGYFTRHLLDRESQFRRIILLES
MDHFMPKIQELHTLYPERVKVRQGDFVNLWKLVYMDKMDGGSRVADLLSD
VPQKAFTDDINMLVFGAVGSYPFFKHLINSLIFQTSLFNLGRCEMILAMP
PPIYIHLTCNNEIGYLIYRSTSVLFQILFEHKFIAKVPREDFLPQQMAYS
PTKSSKLGKVQSINPEYLYLVKFTPRRNLHELCQSQDLPALWFFIKQNYV
SRRNRIIPNLEKWVPGCGPRLIINPKSSESVTPIYPDELPKKLPQYSCQS
TTMSTRNYYPGINIYTQFGDLLPSQILTLFSQFRQWPEYGESSFLASLEN
ALLKLETANDEPNLEDGVTLPEEDDAEADEIIEEESPVPATTPVKRRRKA
SS*

GH04071.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
mtTFB2-PA 452 CG3910-PA 1..452 1..452 2381 100 Plus