Clone GH04132 Report

Search the DGRC for GH04132

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:41
Well:32
Vector:pOT2
Associated Gene/TranscriptCG3652-RA
Protein status:GH04132.pep: gold
Preliminary Size:690
Sequenced Size:825

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3652 2002-01-01 Sim4 clustering to Release 2
CG3652 2002-05-18 Blastp of sequenced clone
CG3652 2003-01-01 Sim4 clustering to Release 3
CG3652 2008-04-29 Release 5.5 accounting
CG3652 2008-08-15 Release 5.9 accounting
CG3652 2008-12-18 5.12 accounting

Clone Sequence Records

GH04132.complete Sequence

825 bp (825 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118733

> GH04132.complete
ACTTAGCAGATAATACCGATGGATTCCAAACTAGATATGTTCGAGGACGT
GAACACGTCGCCTTCATTGGAGGGCGACATGTCGATTCCGGGCAAAAGAA
CCACAACTGCAACGTCCGCGAGCGGAGTGCCGGAATACAATACTCTGGAT
GAGCCCATCCGCGAGACAGTGCTGAGGGACATTCGGGCCGTAGGCATTAA
GTTCTACCACGTCCTGTACCCCAAGGAGAAGTCCAGTCTGCTACGAGATT
GGGACCTTTGGGGTCCACTGGTGCTGTGCACCTTCATGGCCACCATACTA
CAAGGCTCCTCCACCGCCGACAGCATGTCTGACAACGGACCCGAGTTCGC
CCAGGTCTTCGTAATCGTCTGGATAGGTGCAGCCGTAGTCACACTCAACT
CCAAGCTGCTGGGCGGCAATATCTCATTCTTCCAATCCGTCTGCGTGCTG
GGCTACTGCCTTACGCCGGTGGCCATTTCCCTAATTGTGTGCCGGGTAAT
CCTGCTTGCCACCCAAACGCGGCTGCTCTTCTTTCTGCGTTTTGTGACCA
CCACCATAGGCTTTGCCTGGGCCACTTACGCTTCCTTTGTTTTCCTGGGT
CAGAGCCAGCCTCCCCATCGAAAACCGCTTGCCGTGTACCCCATCTTTCT
GTTCTTCTTCATCATCTCGTGGTTGGTTCTTTCCCACAATTAGTCCAATC
TATGACGCCTCGTTTAGTGATTAGTTCGTAAAGAAAACAGTGCACGTTCC
ATAGCGTAACCAAAAAAAAACCGAAAACAATTGTACATTTCTTTAAGCTA
AAAAAAAAAAAAAAAAAAAAAAAAA

GH04132.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG3652-RA 907 CG3652-RA 107..906 1..800 4000 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4391910..4392129 799..580 1100 100 Minus
chr2L 23010047 chr2L 4392641..4392855 251..37 1075 100 Minus
chr2L 23010047 chr2L 4392402..4392573 422..251 860 100 Minus
chr2L 23010047 chr2L 4392182..4392339 580..423 790 100 Minus
chr2L 23010047 chr2L 4392913..4392948 36..1 180 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:30:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4392765..4392989 804..580 1110 99.6 Minus
2L 23513712 2L 4393501..4393715 251..37 1075 100 Minus
2L 23513712 2L 4393262..4393433 422..251 860 100 Minus
2L 23513712 2L 4393042..4393199 580..423 790 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4392765..4392989 804..580 1110 99.5 Minus
2L 23513712 2L 4393501..4393715 251..37 1075 100 Minus
2L 23513712 2L 4393262..4393433 422..251 860 100 Minus
2L 23513712 2L 4393042..4393199 580..423 790 100 Minus
2L 23513712 2L 4393773..4393808 36..1 180 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:32:19 has no hits.

GH04132.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:33:13 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4392402..4392573 251..422 100 <- Minus
chr2L 4392642..4392855 37..250 100 <- Minus
chr2L 4392913..4392948 1..36 100   Minus
chr2L 4391910..4392128 581..799 100 <- Minus
chr2L 4392182..4392339 423..580 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:13:13 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
CG3652-RA 1..675 19..693 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:47 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
CG3652-RA 1..675 19..693 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:39 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
CG3652-RA 1..675 19..693 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:39:04 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
CG3652-RA 1..675 19..693 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:21:01 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
CG3652-RA 1..675 19..693 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:22:32 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
CG3652-RA 7..805 1..799 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:46 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
CG3652-RA 7..805 1..799 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:39 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
CG3652-RA 69..867 1..799 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:39:05 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
CG3652-RA 7..805 1..799 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:01 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
CG3652-RA 69..867 1..799 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:13 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4393042..4393199 423..580 100 <- Minus
2L 4393262..4393433 251..422 100 <- Minus
2L 4393502..4393715 37..250 100 <- Minus
2L 4393773..4393808 1..36 100   Minus
2L 4392770..4392988 581..799 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:13 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4393042..4393199 423..580 100 <- Minus
2L 4393262..4393433 251..422 100 <- Minus
2L 4393502..4393715 37..250 100 <- Minus
2L 4393773..4393808 1..36 100   Minus
2L 4392770..4392988 581..799 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:33:13 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4393042..4393199 423..580 100 <- Minus
2L 4393262..4393433 251..422 100 <- Minus
2L 4393502..4393715 37..250 100 <- Minus
2L 4393773..4393808 1..36 100   Minus
2L 4392770..4392988 581..799 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:39 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4393042..4393199 423..580 100 <- Minus
arm_2L 4393262..4393433 251..422 100 <- Minus
arm_2L 4393502..4393715 37..250 100 <- Minus
arm_2L 4393773..4393808 1..36 100   Minus
arm_2L 4392770..4392988 581..799 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:11:28 Download gff for GH04132.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4392770..4392988 581..799 100 <- Minus
2L 4393042..4393199 423..580 100 <- Minus
2L 4393262..4393433 251..422 100 <- Minus
2L 4393502..4393715 37..250 100 <- Minus
2L 4393773..4393808 1..36 100   Minus

GH04132.pep Sequence

Translation from 18 to 692

> GH04132.pep
MDSKLDMFEDVNTSPSLEGDMSIPGKRTTTATSASGVPEYNTLDEPIRET
VLRDIRAVGIKFYHVLYPKEKSSLLRDWDLWGPLVLCTFMATILQGSSTA
DSMSDNGPEFAQVFVIVWIGAAVVTLNSKLLGGNISFFQSVCVLGYCLTP
VAISLIVCRVILLATQTRLLFFLRFVTTTIGFAWATYASFVFLGQSQPPH
RKPLAVYPIFLFFFIISWLVLSHN*

GH04132.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:05:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24098-PA 226 GF24098-PA 1..226 1..224 1106 92.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24381-PA 224 GG24381-PA 1..224 1..224 1157 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13681-PA 226 GH13681-PA 1..226 1..224 1079 89.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG3652-PA 224 CG3652-PA 1..224 1..224 1161 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17966-PA 223 GI17966-PA 1..223 1..224 1121 92.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15435-PA 226 GL15435-PA 1..226 1..224 1128 93.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17589-PA 226 GA17589-PA 1..226 1..224 1128 93.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18096-PA 224 GM18096-PA 1..224 1..224 1159 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22713-PA 224 GD22713-PA 1..224 1..224 1166 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16306-PA 225 GJ16306-PA 1..225 1..224 1102 92.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24331-PA 226 GK24331-PA 1..226 1..224 1090 90.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14742-PA 224 GE14742-PA 1..224 1..224 1160 97.8 Plus

GH04132.hyp Sequence

Translation from 18 to 692

> GH04132.hyp
MDSKLDMFEDVNTSPSLEGDMSIPGKRTTTATSASGVPEYNTLDEPIRET
VLRDIRAVGIKFYHVLYPKEKSSLLRDWDLWGPLVLCTFMATILQGSSTA
DSMSDNGPEFAQVFVIVWIGAAVVTLNSKLLGGNISFFQSVCVLGYCLTP
VAISLIVCRVILLATQTRLLFFLRFVTTTIGFAWATYASFVFLGQSQPPH
RKPLAVYPIFLFFFIISWLVLSHN*

GH04132.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG3652-PA 224 CG3652-PA 1..224 1..224 1161 100 Plus