Clone GH04205 Report

Search the DGRC for GH04205

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:42
Well:5
Vector:pOT2
Associated Gene/TranscriptXport-RA
Protein status:GH04205.pep: gold
Preliminary Size:1300
Sequenced Size:944

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4468 2001-01-01 Release 2 assignment
CG4468 2002-05-30 Blastp of sequenced clone
CG4468 2003-01-01 Sim4 clustering to Release 3
CG4468 2008-04-29 Release 5.5 accounting
CG4468 2008-08-15 Release 5.9 accounting
CG4468 2008-12-18 5.12 accounting

Clone Sequence Records

GH04205.complete Sequence

944 bp (944 high quality bases) assembled on 2002-05-30

GenBank Submission: AY118295

> GH04205.complete
CGAGGAAGCACCAGGCGGAGAGCACTTCCAGGACCAACTCCAATCAAATG
CAGTGCTGTGCAGGCTGACCGACCAACTGCTGCTATCTGGATGCAATGAA
GCCGAAGAAATCGGCCTTTGCCAATTCATCCACGGGATACGGCAGGAACA
AGCACGGTAAAGGACACTCTGGCAAGGATAAAGTCGAGGGTGGTGGTAAG
GGCAAGAGCCGAGACGAGAAGGATAAGCATAAGCATGAGCAGAAGGTGGA
CGAGAAGGATGACAAGGATCTAAATTCCGGCTTCGGCGACTATCTTCGCA
CTCCGGAGGCATTTGAAATGATGAAACTCTTTGTCTTCGCCAATACCATA
ATGCTAATTGTCACCATGGCCTGGCCGCACATCAAGGAGCAATTCTACAT
GGTTAATCAATGGCTTGAAAGCTTCCGCGAGGAGCATCAGCAGTAGAAAC
CAAAGGATCTATCGAACAAATAAGTAAATCAAGTGGAAGCATACAATATG
GTCGGTCCATTCATGCAGGGCCTATTCTTGATTGGCATCATCTACTGGTA
TTCCAAGGGGATGATGTCCATGATCAACGACTACTACAGAAGTGAGTTCC
AGCGAAAGTTGCAGACGGAACCAGCAAAGACGAGGGCAGAGACACCCATC
AATGTGGACAACTTTATGGATTATGTTAGGGAGCTGGACACTCCGGACGA
GGTGGCTAGAATTCCGGCGGAAGGAACTGAATCTCCGCCCATGGGAAACA
CCTATTGCCACATCCTTCGACGATTCTTGGAGATTACCGGCACTCTACCA
CCATTCGATGTTTGCCTAGTTACGAGCAACATAAGATAGCCCATCCTATA
ATTAATTATATATGGTATCAATTATACTTAGTGTGTTTTATATGAGTTTC
GTAGAATAAAATATCTTACTAACCGTAAAAAAAAAAAAAAAAAA

GH04205.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42508-RA 946 CG42508-RA 21..946 1..926 4630 100 Plus
CG4468-RA 946 CG4468-RA 21..946 1..926 4630 100 Plus
nc_17835.a 632 nc_17835.a 2..632 1..627 3070 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15738310..15738927 926..309 2985 98.9 Minus
chr3R 27901430 chr3R 15738995..15739303 309..1 1530 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:31:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19914395..19915013 927..309 3095 100 Minus
3R 32079331 3R 19915081..19915389 309..1 1545 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19655226..19655844 927..309 3095 100 Minus
3R 31820162 3R 19655912..19656220 309..1 1545 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:47:12 has no hits.

GH04205.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:48:05 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15738310..15738926 310..926 98 <- Minus
chr3R 15738995..15739303 1..309 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:13:24 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
CG4468-RA 1..351 96..446 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:36:38 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
CG4468-RA 1..351 96..446 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:47:06 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
Xport-RA 1..351 96..446 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:28:16 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
CG4468-RA 1..351 96..446 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:47:34 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
Xport-RA 1..351 96..446 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:08:47 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
CG4468-RA 21..946 1..926 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:36:38 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
CG4468-RA 21..946 1..926 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:47:06 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
Xport-RA 21..946 1..926 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:28:17 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
CG4468-RA 21..946 1..926 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:47:34 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
Xport-RA 24..949 1..926 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:48:05 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19914396..19915012 310..926 100 <- Minus
3R 19915081..19915389 1..309 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:48:05 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19914396..19915012 310..926 100 <- Minus
3R 19915081..19915389 1..309 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:48:05 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19914396..19915012 310..926 100 <- Minus
3R 19915081..19915389 1..309 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:47:06 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15740803..15741111 1..309 100   Minus
arm_3R 15740118..15740734 310..926 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:00:48 Download gff for GH04205.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19655227..19655843 310..926 100 <- Minus
3R 19655912..19656220 1..309 100   Minus

GH04205.hyp Sequence

Translation from 95 to 445

> GH04205.hyp
MKPKKSAFANSSTGYGRNKHGKGHSGKDKVEGGGKGKSRDEKDKHKHEQK
VDEKDDKDLNSGFGDYLRTPEAFEMMKLFVFANTIMLIVTMAWPHIKEQF
YMVNQWLESFREEHQQ*

GH04205.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
Xport-PA 116 CG4468-PA 1..116 1..116 628 100 Plus

GH04205.pep Sequence

Translation from 95 to 445

> GH04205.pep
MKPKKSAFANSSTGYGRNKHGKGHSGKDKVEGGGKGKSRDEKDKHKHEQK
VDEKDDKDLNSGFGDYLRTPEAFEMMKLFVFANTIMLIVTMAWPHIKEQF
YMVNQWLESFREEHQQ*

GH04205.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17348-PA 117 GF17348-PA 1..117 1..116 436 75 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15741-PA 119 GG15741-PA 1..119 1..116 514 89.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19615-PA 118 GH19615-PA 1..118 1..114 400 68.3 Plus
Dgri\GH23280-PA 118 GH23280-PA 1..118 1..114 397 68.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
Xport-A-PA 116 CG4468-PA 1..116 1..116 628 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10324-PA 115 GI10324-PA 1..114 1..116 410 69.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12528-PA 121 GL12528-PA 1..120 1..115 451 73.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18207-PA 121 GA18207-PA 1..120 1..115 426 71.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26884-PA 116 GM26884-PA 1..116 1..116 607 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20092-PA 116 GD20092-PA 1..116 1..116 611 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10179-PA 117 GJ10179-PA 1..116 1..116 389 66.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22804-PA 111 GK22804-PA 1..111 1..116 317 61.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25102-PA 120 GE25102-PA 1..120 1..116 576 91.7 Plus