Clone GH04238 Report

Search the DGRC for GH04238

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:42
Well:38
Vector:pOT2
Associated Gene/TranscriptCG5597-RA
Protein status:GH04238.pep: gold
Preliminary Size:1300
Sequenced Size:915

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5597 2001-01-01 Release 2 assignment
CG5597 2002-05-17 Blastp of sequenced clone
CG5597 2003-01-01 Sim4 clustering to Release 3
CG5597 2008-04-29 Release 5.5 accounting
CG5597 2008-08-15 Release 5.9 accounting
CG5597 2008-12-18 5.12 accounting

Clone Sequence Records

GH04238.complete Sequence

915 bp (915 high quality bases) assembled on 2002-05-17

GenBank Submission: AY118734

> GH04238.complete
CCGAGCGGACCGCTGAGTTAGGATCGGTTGAGAAGTCTGGCATACGAGTG
GAAGTGGAAGTGTAGATAGGATAGTGACCGTTATGGATACCCTGCTGATC
GCCATTCTGGCCATCGGACTGCTCCACAGAGATGCGCTATGCTATCCCAC
GAGGGATGAGTCCGAGGACAAGATTATAGTCCTTCAGAACGAGGAGATGG
AGCCCACGATCCTGGACTGCGACTACGAGGTGGAGGAGAGCCCGAAGTTC
ATCACCGTCAAATGGTACAGAGACGACAAGTCCATATACCAGTGGATCTT
CGGAACACCTCCATATGCCATCCCCGAGTTCAGGAACGAGATTGACAGCA
CCTATGAGAGCTCCACGGAGCCGAGCAAGCAGTACAGCTCGCTGGCTTTG
ATCAACCCCACGATCGCCACCACCGGCGACTACAAGTGCGTGGTGCAGAC
CTCGCTGAACACCTTCTCCAGCCACCAGAGGGTTCAGGTCATAGACCTGA
GGAACTACACCCTGGAGCTGTCCCACAAGACGATCCACAATGAGACGCAG
CTGAACTGCACCGTGACGAACGTGTATCCCAGGCCCACCATCACGATAAT
ATCCAACGACATGGACGTGGTGAAGCGGGAGCCCATGGTGTACGAGAACG
AGGAGGGATACTTCGATGGCAGCGCCGTGGTGGCGGCCTACGACACCGAC
GACGATCCCGATGCCTACCAGTGCGTGGTGTCCTTCGAGGGATACGGCAA
GAACCTGACCACGGTGGCCACGTCCGCGGCGGCGGGCAGGAGCCACGTCG
ACTTCAGCCTGTGGCTGTTTTGTTTTCTGTACTACCTGCTCTGCAAGCTG
AAGGTATTGGCCTAAATAAAAGCGTTGTTATTTATTGTTACTAAATTAAA
AAAAAAAAAAAAAAA

GH04238.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG5597-RA 1158 CG5597-RA 167..1065 1..899 4495 100 Plus
CG5597.a 933 CG5597.a 73..840 132..899 3840 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19774524..19774820 601..897 1485 100 Plus
chr2R 21145070 chr2R 19774168..19774445 323..600 1390 100 Plus
chr2R 21145070 chr2R 19773915..19774107 130..322 965 100 Plus
chr2R 21145070 chr2R 19773039..19773169 1..131 655 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:31:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23888481..23888779 601..899 1495 100 Plus
2R 25286936 2R 23888125..23888402 323..600 1390 100 Plus
2R 25286936 2R 23887872..23888064 130..322 965 100 Plus
2R 25286936 2R 23886996..23887126 1..131 655 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23889680..23889978 601..899 1495 100 Plus
2R 25260384 2R 23889324..23889601 323..600 1390 100 Plus
2R 25260384 2R 23889071..23889263 130..322 965 100 Plus
2R 25260384 2R 23888195..23888325 1..131 655 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:13:23 has no hits.

GH04238.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:14:18 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19773039..19773169 1..131 100 -> Plus
chr2R 19773917..19774107 132..322 100 -> Plus
chr2R 19774168..19774445 323..600 100 -> Plus
chr2R 19774524..19774820 601..897 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:13:32 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
CG5597-RA 1..783 83..865 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:49:33 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
CG5597-RA 1..783 83..865 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:57:48 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
CG5597-RA 1..783 83..865 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:42:10 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
CG5597-RA 1..783 83..865 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:00:39 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
CG5597-RA 1..783 83..865 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:26:34 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
CG5597-RA 23..919 1..897 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:49:32 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
CG5597-RA 23..919 1..897 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:57:48 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
CG5597-RA 24..920 1..897 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:42:10 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
CG5597-RA 23..919 1..897 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:00:39 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
CG5597-RA 24..920 1..897 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:18 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23886996..23887126 1..131 100 -> Plus
2R 23887874..23888064 132..322 100 -> Plus
2R 23888125..23888402 323..600 100 -> Plus
2R 23888481..23888777 601..897 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:18 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23886996..23887126 1..131 100 -> Plus
2R 23887874..23888064 132..322 100 -> Plus
2R 23888125..23888402 323..600 100 -> Plus
2R 23888481..23888777 601..897 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:18 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23886996..23887126 1..131 100 -> Plus
2R 23887874..23888064 132..322 100 -> Plus
2R 23888125..23888402 323..600 100 -> Plus
2R 23888481..23888777 601..897 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:57:48 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19774519..19774649 1..131 100 -> Plus
arm_2R 19775397..19775587 132..322 100 -> Plus
arm_2R 19775648..19775925 323..600 100 -> Plus
arm_2R 19776004..19776300 601..897 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:14:26 Download gff for GH04238.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23889342..23889619 323..600 100 -> Plus
2R 23889698..23889994 601..897 100   Plus
2R 23888213..23888343 1..131 100 -> Plus
2R 23889091..23889281 132..322 100 -> Plus

GH04238.hyp Sequence

Translation from 82 to 864

> GH04238.hyp
MDTLLIAILAIGLLHRDALCYPTRDESEDKIIVLQNEEMEPTILDCDYEV
EESPKFITVKWYRDDKSIYQWIFGTPPYAIPEFRNEIDSTYESSTEPSKQ
YSSLALINPTIATTGDYKCVVQTSLNTFSSHQRVQVIDLRNYTLELSHKT
IHNETQLNCTVTNVYPRPTITIISNDMDVVKREPMVYENEEGYFDGSAVV
AAYDTDDDPDAYQCVVSFEGYGKNLTTVATSAAAGRSHVDFSLWLFCFLY
YLLCKLKVLA*

GH04238.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG5597-PA 260 CG5597-PA 1..260 1..260 1373 100 Plus
CG13532-PA 263 CG13532-PA 39..177 33..173 168 27.6 Plus

GH04238.pep Sequence

Translation from 82 to 864

> GH04238.pep
MDTLLIAILAIGLLHRDALCYPTRDESEDKIIVLQNEEMEPTILDCDYEV
EESPKFITVKWYRDDKSIYQWIFGTPPYAIPEFRNEIDSTYESSTEPSKQ
YSSLALINPTIATTGDYKCVVQTSLNTFSSHQRVQVIDLRNYTLELSHKT
IHNETQLNCTVTNVYPRPTITIISNDMDVVKREPMVYENEEGYFDGSAVV
AAYDTDDDPDAYQCVVSFEGYGKNLTTVATSAAAGRSHVDFSLWLFCFLY
YLLCKLKVLA*

GH04238.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12870-PA 261 GF12870-PA 1..260 1..259 1005 69.6 Plus
Dana\GF13550-PA 262 GF13550-PA 39..178 35..175 184 29 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22897-PA 260 GG22897-PA 1..259 1..259 1282 91.9 Plus
Dere\GG22809-PA 263 GG22809-PA 39..177 33..173 171 27.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21689-PA 235 GH21689-PA 6..232 20..241 562 49.3 Plus
Dgri\GH21798-PA 263 GH21798-PA 41..177 35..173 184 30.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG5597-PA 260 CG5597-PA 1..260 1..260 1373 100 Plus
CG13532-PA 263 CG13532-PA 39..177 33..173 168 27.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18843-PA 260 GI18843-PA 18..260 19..260 699 56.1 Plus
Dmoj\GI20547-PA 263 GI20547-PA 41..177 35..173 186 30.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11173-PA 260 GL11173-PA 1..259 1..259 960 67.3 Plus
Dper\GL10131-PA 261 GL10131-PA 39..187 35..183 192 32.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18997-PA 260 GA18997-PA 1..259 1..259 960 67.3 Plus
Dpse\GA12347-PA 261 GA12347-PA 39..187 35..183 192 32.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16057-PA 260 GM16057-PA 1..260 1..260 1376 98.8 Plus
Dsec\GM13667-PA 135 GM13667-PA 1..135 39..173 713 98.5 Plus
Dsec\GM15966-PA 263 GM15966-PA 39..177 33..173 171 27.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11805-PA 260 GD11805-PA 1..260 1..260 1372 98.8 Plus
Dsim\GD11718-PA 263 GD11718-PA 39..177 33..173 171 27.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21874-PA 258 GJ21874-PA 13..257 16..259 738 56.5 Plus
Dvir\GJ22400-PA 263 GJ22400-PA 41..177 35..173 184 32.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15917-PA 582 GK15917-PA 328..577 8..252 829 61.7 Plus
Dwil\GK15667-PA 374 GK15667-PA 191..354 18..181 621 67.1 Plus
Dwil\GK20788-PA 261 GK20788-PA 42..175 38..173 186 31.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14335-PA 260 GE14335-PA 1..259 1..259 1304 93.1 Plus
Dyak\GE14243-PA 263 GE14243-PA 39..177 33..173 170 27.6 Plus