Clone GH04282 Report

Search the DGRC for GH04282

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:42
Well:82
Vector:pOT2
Associated Gene/TranscriptCG11425-RA
Protein status:GH04282.pep: gold
Sequenced Size:1048

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11425 2003-01-01 Sim4 clustering to Release 3
CG11425 2008-04-29 Release 5.5 accounting
CG11425 2008-04-29 Picked prior to 5.5
CG11425 2008-08-15 Release 5.9 accounting
CG11425 2008-12-18 5.12 accounting

Clone Sequence Records

GH04282.complete Sequence

1048 bp assembled on 2007-11-15

GenBank Submission: BT031192

> GH04282.complete
TTGAATCGATCGCACGGATCGCGGGTCGAGCATTAAAAATGAGCTTTAAT
TTAAGTCTGCGGCCCCCCATCCGCCTCCTGGTGGACCTGGTCCTGCTGGG
CCTACTTATTGTCCTGGTGGAGAACTTCCGTCGCTTGTGGGGGCCTCCGA
CGAAGCGTGGTTTCTTCTGTGATGACGAGTCCTTAATGTATCCCTACCAC
GAAAACACAGTGAGCCCCACGCTGCTCCACTGGCTGGGACTGTACCTTCC
ACTGATCAGTCTGGTCGTCCTTGAAAGCTTTCTCAGCCACCGGAAGGACA
TGGCCCCCTGGCCAACACTATGGCCGGTGTACAACACTGTGCGCTGGTTC
CTTTACGGCTACGTATCCAACGACCTGCTCAAGGGAATCGGAAAGCAGGC
ACTTGGGCGACTGAGGCCCCACTTCTTTGCCGTGTGCAGTCCACATTTCC
CGGACGGCTCCAGCTGCTTAGATGAGTCGCATCGAGGTGCTCTGAAATAC
CACACAGACTACGAGTGTCGGCCAAATCTTTCGCAAGCCACCGAGGAAAT
GATTCGTGACGTAAACGTGTCCTTTCCCAGCGGCCATTCCGCCATGGCTT
TCTACGGCTTGGTGTTTGTGGCGCTGCACCTGCGCCGCCGCCGCTGGCCT
CTCCGTGGATCCTTGCTTAGTCCTGTGCTGCAGCTAGCTTGCGTGGCTCT
GGCCTGGTTCGTGGCCATCAGCCGGGTCATCGACTACAAACACCACTGGT
CGGATGTTGCGGCCGGTTCGCTGTTGGGTGCCGGGAGCGCCCTTGCGGTT
ACTCGGGCTGCCGCGTCCGAGGAGCTACAATGGAGGTGCCAGGATTCACT
GGCGAGTGCGAAGCAGGAGGCTGCAGTGGTCGATGTGGCCGACGTCAAAG
GGGGCCAACAGATGCCGCATGATTTGTCTCTAGTTACGTGCCACATCTCT
AATTAGTCGTAGTTTCGTTTTAAGGTCGACAATAAAGCTAGTGACAAGAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH04282.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG11425-RA 998 CG11425-RA 1..998 1..998 4990 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22463703..22464700 1..998 4990 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:31:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22474795..22475793 1..999 4995 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22467895..22468893 1..999 4995 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:13:17 has no hits.

GH04282.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:13:55 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22463703..22464700 1..998 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:13:47 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG11425-RA 1..918 39..956 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:01:39 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG11425-RA 1..918 39..956 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:32:53 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG11425-RA 1..918 39..956 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:47:10 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG11425-RA 1..918 39..956 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:24:20 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG11425-RA 1..918 39..956 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:46:00 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG11425-RA 1..956 1..956 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:01:39 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG11425-RA 1..998 1..998 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:32:53 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG11425-RA 1..998 1..998 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:47:10 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG11425-RA 1..956 1..956 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:24:20 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG11425-RA 1..998 1..998 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:55 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22474795..22475792 1..998 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:55 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22474795..22475792 1..998 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:55 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22474795..22475792 1..998 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:32:53 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22467895..22468892 1..998 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:53:34 Download gff for GH04282.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22467895..22468892 1..998 100   Plus

GH04282.hyp Sequence

Translation from 2 to 955

> GH04282.hyp
ESIARIAGRALKMSFNLSLRPPIRLLVDLVLLGLLIVLVENFRRLWGPPT
KRGFFCDDESLMYPYHENTVSPTLLHWLGLYLPLISLVVLESFLSHRKDM
APWPTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFP
DGSSCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAF
YGLVFVALHLRRRRWPLRGSLLSPVLQLACVALAWFVAISRVIDYKHHWS
DVAAGSLLGAGSALAVTRAAASEELQWRCQDSLASAKQEAAVVDVADVKG
GQQMPHDLSLVTCHISN*

GH04282.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG11425-PA 305 CG11425-PA 1..305 13..317 1624 100 Plus
wun-PC 364 CG8804-PC 92..343 32..267 454 38.8 Plus
wun-PA 300 CG8804-PA 13..263 32..266 453 38.9 Plus
wun-PB 379 CG8804-PB 92..342 32..266 453 38.9 Plus
CG11426-PA 340 CG11426-PA 37..282 24..264 440 40.6 Plus

GH04282.pep Sequence

Translation from 38 to 955

> GH04282.pep
MSFNLSLRPPIRLLVDLVLLGLLIVLVENFRRLWGPPTKRGFFCDDESLM
YPYHENTVSPTLLHWLGLYLPLISLVVLESFLSHRKDMAPWPTLWPVYNT
VRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDGSSCLDESHRG
ALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAFYGLVFVALHLRR
RRWPLRGSLLSPVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLGAGS
ALAVTRAAASEELQWRCQDSLASAKQEAAVVDVADVKGGQQMPHDLSLVT
CHISN*

GH04282.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:53:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10981-PA 303 GF10981-PA 1..303 1..305 910 64.3 Plus
Dana\GF13080-PA 377 GF13080-PA 104..337 33..254 451 41.3 Plus
Dana\GF11822-PA 347 GF11822-PA 89..343 12..255 414 37.4 Plus
Dana\GF10980-PA 345 GF10980-PA 63..288 37..256 400 39.4 Plus
Dana\GF10978-PA 335 GF10978-PA 33..238 37..247 370 37.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16259-PA 305 GG16259-PA 1..305 1..305 1280 87.2 Plus
Dere\GG10557-PA 372 GG10557-PA 83..335 18..254 457 40.2 Plus
Dere\GG16258-PA 340 GG16258-PA 61..282 37..252 384 42.4 Plus
Dere\GG23436-PA 351 GG23436-PA 91..347 12..255 369 34.7 Plus
Dere\GG16256-PA 341 GG16256-PA 9..252 12..247 367 34.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16696-PA 330 GH16696-PA 30..330 28..305 726 53.3 Plus
Dgri\GH21309-PA 380 GH21309-PA 95..343 18..254 491 44 Plus
Dgri\GH16694-PA 345 GH16694-PA 41..290 12..256 444 38.9 Plus
Dgri\GH20575-PA 365 GH20575-PA 107..363 12..254 394 36.2 Plus
Dgri\GH16692-PA 348 GH16692-PA 9..248 12..247 358 34.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG11425-PA 305 CG11425-PA 1..305 1..305 1624 100 Plus
wun-PC 364 CG8804-PC 92..343 20..255 454 38.8 Plus
wun-PA 300 CG8804-PA 13..263 20..254 453 38.9 Plus
wun-PB 379 CG8804-PB 92..342 20..254 453 38.9 Plus
CG11426-PA 340 CG11426-PA 37..282 12..252 440 40.6 Plus
wun2-PA 350 CG8805-PA 90..346 12..255 415 35.9 Plus
wun2-PB 246 CG8805-PB 6..242 33..255 402 36.1 Plus
CG11438-PB 341 CG11438-PB 31..250 35..247 375 37.1 Plus
CG11438-PA 341 CG11438-PA 31..250 35..247 375 37.1 Plus
laza-PA 334 CG11440-PA 5..218 39..257 361 39.9 Plus
CG11437-PA 305 CG11437-PA 1..268 1..255 247 29.5 Plus
CG12746-PE 363 CG12746-PE 69..291 14..247 171 26.6 Plus
CG12746-PD 363 CG12746-PD 69..291 14..247 171 26.6 Plus
CG12746-PB 363 CG12746-PB 69..291 14..247 171 26.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11384-PA 321 GI11384-PA 36..321 30..305 805 55.5 Plus
Dmoj\GI19743-PA 298 GI19743-PA 11..261 18..254 451 40.2 Plus
Dmoj\GI19768-PA 375 GI19768-PA 116..371 12..255 404 34.9 Plus
Dmoj\GI11383-PA 345 GI11383-PA 42..294 12..259 390 39.2 Plus
Dmoj\GI11380-PA 340 GI11380-PA 8..249 7..247 366 34.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23176-PA 274 GL23176-PA 1..274 50..305 817 60.2 Plus
Dper\GL16886-PA 306 GL16886-PA 11..263 18..254 438 38.2 Plus
Dper\GL17588-PA 372 GL17588-PA 110..368 12..255 397 34.1 Plus
Dper\GL23165-PA 343 GL23165-PA 61..289 37..259 381 37.3 Plus
Dper\GL23143-PA 328 GL23143-PA 30..235 34..247 302 34 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10998-PA 323 GA10998-PA 1..323 1..305 925 60.7 Plus
Dpse\GA21332-PA 386 GA21332-PA 91..343 18..254 441 38.6 Plus
Dpse\GA21332-PC 306 GA21332-PC 11..263 18..254 439 38.6 Plus
Dpse\GA21332-PB 365 GA21332-PB 91..354 18..265 439 37.4 Plus
Dpse\GA24835-PA 369 GA24835-PA 107..365 12..255 397 34.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22449-PA 305 GM22449-PA 1..305 1..305 1407 92.1 Plus
Dsec\GM20603-PA 372 GM20603-PA 83..335 18..254 454 39.8 Plus
Dsec\GM22448-PA 340 GM22448-PA 61..282 37..252 421 42.4 Plus
Dsec\GM21120-PA 350 GM21120-PA 90..346 12..255 389 35.5 Plus
Dsec\GM22445-PA 341 GM22445-PA 31..250 35..247 366 35.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15032-PA 305 GD15032-PA 1..305 1..305 1400 93.8 Plus
Dsim\GD10076-PA 372 GD10076-PA 83..335 18..254 468 40.6 Plus
Dsim\GD15031-PA 340 GD15031-PA 61..282 37..252 421 42.4 Plus
Dsim\GD10653-PA 350 GD10653-PA 90..346 12..255 382 35.5 Plus
Dsim\GD15029-PA 341 GD15029-PA 31..250 35..247 367 35.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11639-PA 318 GJ11639-PA 35..318 29..305 857 56.7 Plus
Dvir\GJ18026-PA 378 GJ18026-PA 110..341 33..254 451 42.4 Plus
Dvir\GJ11638-PA 337 GJ11638-PA 33..285 12..259 426 39.1 Plus
Dvir\GJ18273-PA 332 GJ18273-PA 80..312 33..254 386 36 Plus
Dvir\GJ11635-PA 345 GJ11635-PA 33..253 37..247 371 36 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16762-PA 576 GK16762-PA 12..319 11..305 872 55.5 Plus
Dwil\GK21745-PA 385 GK21745-PA 94..384 18..300 453 36.4 Plus
Dwil\GK21557-PA 361 GK21557-PA 98..357 12..255 401 36 Plus
Dwil\GK16761-PA 362 GK16761-PA 54..299 12..252 384 37.6 Plus
Dwil\GK16759-PA 364 GK16759-PA 9..261 12..247 364 35.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19507-PA 305 GE19507-PA 1..305 1..305 1370 89.8 Plus
Dyak\GE23020-PA 305 GE23020-PA 1..305 1..305 1362 89.5 Plus
Dyak\GE22302-PA 369 GE22302-PA 80..358 18..280 463 38 Plus
Dyak\GE19506-PA 340 GE19506-PA 61..282 37..252 388 43 Plus
Dyak\GE23019-PA 340 GE23019-PA 61..282 37..252 387 43 Plus