Clone GH04443 Report

Search the DGRC for GH04443

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:44
Well:43
Vector:pOT2
Associated Gene/TranscriptVps28-RA
Protein status:GH04443.pep: gold
Preliminary Size:791
Sequenced Size:812

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12770 2001-01-01 Release 2 assignment
CG12770 2001-10-10 Blastp of sequenced clone
CG12770 2003-01-01 Sim4 clustering to Release 3
Vps28 2008-04-29 Release 5.5 accounting
Vps28 2008-08-15 Release 5.9 accounting
Vps28 2008-12-18 5.12 accounting

Clone Sequence Records

GH04443.complete Sequence

812 bp (812 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060620

> GH04443.complete
CCACACTGTCAAATCCCTGTGAATCATTGTTTTGTGTTTAAAACTAGAAA
ATATTTGAGCCAGAAACAAATTACGAGATGCAGGAACAAAGTCCCGAGCT
GTACGAGGAGGTGAAGCTCTTCCGTAACGCCCGCGAGCGCGAGAAGTACG
ACAACATGGCCGATCTATACGCAATCATCAACACCATCCAGCAGCTGGAG
AAGGCCTACATCCGCGACTGCATTACGCCGCAGGAATACACGGCCGCCTG
CTCCAAATACCTGGTGCAGTACAAGGTGGCCTTTAAGCAGGTGCAGTGCG
ACGAATTCCCCTCGGTGGAGACGTTCGTTAAGAAATTCCGGCTGGACTGC
CCTGCTGCGCTGGAGCGGATCCGCGAGGACCGACCCATCACCATACGCGA
CGATAAGGGCAACACCTCCAAATGCATCGCCGAGATCGTGTCGCTGTTCA
TCACAATCATGGACAAGCTACGCCTGCAGATCAACACCATGGACGCCCTA
CAGCCGGACGTCAAAGACCTGGCTGACAACATGAATCGCCTGTCCCTCAT
TCCCGAGGACTTCGACGCCAAGCTGAAGGTGGAGAAGTGGCTGGGCAGCC
TGAACGAGATGCAGGCCTCCGACGAGTTGAGCGAGGGCCAGGTCCGCCAG
TTCCTCTTCGACCTGGAGTCGGCGTACGCGGACTTCAACAAGCTGCTGCA
CAGCCAGTAGCTATCAGTTTCTCATTGTTTACGTGTATCCCTAAATTTAT
ATAGCATGTTCCGATATTAAACAAGTTTGATATATCACCTTAAAAAAAAA
AAAAAAAAAAAA

GH04443.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
Vps28-RA 820 Vps28-RA 30..820 1..791 3955 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3966656..3967446 791..1 3955 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:31:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8079236..8080027 792..1 3960 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:17:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8080435..8081226 792..1 3960 100 Minus
Blast to na_te.dros performed on 2019-03-15 12:37:18 has no hits.

GH04443.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:38:24 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3966656..3967446 1..791 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:13:59 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
Vps28-RA 1..633 78..710 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:57:47 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
Vps28-RA 1..633 78..710 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:47:27 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
Vps28-RA 1..633 78..710 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:40:49 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
Vps28-RA 1..633 78..710 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:06:09 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
Vps28-RA 1..633 78..710 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:12:01 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
Vps28-RA 9..799 1..791 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:57:47 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
Vps28-RA 30..820 1..791 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:47:27 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
Vps28-RA 15..805 1..791 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:40:49 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
Vps28-RA 9..799 1..791 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:06:09 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
Vps28-RA 15..805 1..791 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:24 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8079237..8080027 1..791 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:24 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8079237..8080027 1..791 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:24 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8079237..8080027 1..791 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:47:27 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3966742..3967532 1..791 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:23:56 Download gff for GH04443.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8080436..8081226 1..791 100   Minus

GH04443.hyp Sequence

Translation from 77 to 709

> GH04443.hyp
MQEQSPELYEEVKLFRNAREREKYDNMADLYAIINTIQQLEKAYIRDCIT
PQEYTAACSKYLVQYKVAFKQVQCDEFPSVETFVKKFRLDCPAALERIRE
DRPITIRDDKGNTSKCIAEIVSLFITIMDKLRLQINTMDALQPDVKDLAD
NMNRLSLIPEDFDAKLKVEKWLGSLNEMQASDELSEGQVRQFLFDLESAY
ADFNKLLHSQ*

GH04443.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
Vps28-PB 210 CG12770-PB 1..210 1..210 1076 100 Plus
Vps28-PA 210 CG12770-PA 1..210 1..210 1076 100 Plus

GH04443.pep Sequence

Translation from 77 to 709

> GH04443.pep
MQEQSPELYEEVKLFRNAREREKYDNMADLYAIINTIQQLEKAYIRDCIT
PQEYTAACSKYLVQYKVAFKQVQCDEFPSVETFVKKFRLDCPAALERIRE
DRPITIRDDKGNTSKCIAEIVSLFITIMDKLRLQINTMDALQPDVKDLAD
NMNRLSLIPEDFDAKLKVEKWLGSLNEMQASDELSEGQVRQFLFDLESAY
ADFNKLLHSQ*

GH04443.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11216-PA 210 GF11216-PA 1..210 1..210 1068 95.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10681-PA 210 GG10681-PA 1..210 1..210 1104 99.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19992-PA 210 GH19992-PA 1..210 1..210 1068 95.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
Vps28-PB 210 CG12770-PB 1..210 1..210 1076 100 Plus
Vps28-PA 210 CG12770-PA 1..210 1..210 1076 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20167-PA 210 GI20167-PA 1..210 1..210 1060 94.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10599-PA 211 GL10599-PA 2..211 1..210 1082 96.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11803-PA 211 GA11803-PA 2..211 1..210 1085 97.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20728-PA 210 GM20728-PA 1..210 1..210 1110 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15294-PA 210 GD15294-PA 1..210 1..210 1110 100 Plus
Dsim\GD10195-PA 210 GD10195-PA 1..210 1..210 1110 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20232-PA 210 GJ20232-PA 1..210 1..210 1060 94.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23164-PA 210 GK23164-PA 1..210 1..210 1034 91.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23355-PA 210 GE23355-PA 1..210 1..210 1106 99.5 Plus