Clone GH04494 Report

Search the DGRC for GH04494

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:44
Well:94
Vector:pOT2
Associated Gene/TranscriptCG32240-RA
Protein status:GH04494.pep: gold
Sequenced Size:601

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32240 2002-11-11 Blastp of sequenced clone
CG32240 2003-01-01 Sim4 clustering to Release 3
CG32240 2008-04-29 Release 5.5 accounting
CG32240 2008-08-15 Release 5.9 accounting
CG32240 2008-12-18 5.12 accounting

Clone Sequence Records

GH04494.complete Sequence

601 bp (601 high quality bases) assembled on 2002-11-11

GenBank Submission: BT001386

> GH04494.complete
CATAACACTAGTTAGCTGATTTTCAAAATTTTATCCGGTCTTCAAAAGGT
AGCCAGTCGCAGCCAGTCGATCAGGCCAATGATGATGCCTCAATTTGTGT
TCTGGAGGAGGGATGCCAAAAAGACCCAGCTGGAGCAGATCTCGCCCATC
TGGAGGGATTTGAATGCTACATTTGTGACGGTTCTCAGCTGGAGTTGGCT
CATCTACGCACTTTCCGCACTGGTAATCATCACTTGTGCATATTTCGCTT
ATTGTGAGCGCTGCCGAAGAACTGAATCAGTGCGACGACGACGGGTGATT
CAAAGAGCTCAAGAGCGACCGCCACAAAAGCGACGACCGAATGCGGCCTA
TCGGGATCACCAGATCTACCGCCACATCATCCTCAGCGTGGCCAAGTACA
TGAAGAATCCGGATGGTATTCGACCCTTTATAGAACACATGGAGCAGCTA
TATCCACTCAGGCATAACTTGGCCGATCAGCAGCAGGTGGCCGAACCAAG
TGCTGGAGAAGATTAGTGATCAGGGAGGTAAAACCAAAAGATTTGAATCC
AAAATTAATAGAATAAATACTGCGAAAATTAAAAAAAAAAAAAAAAAAAA
A

GH04494.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG32240-RA 703 CG32240-RA 87..669 1..583 2915 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4380252..4380515 580..317 1290 99.2 Minus
chr3L 24539361 chr3L 4380773..4380952 180..1 900 100 Minus
chr3L 24539361 chr3L 4380578..4380715 317..180 645 97.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:31:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4380861..4381127 583..317 1335 100 Minus
3L 28110227 3L 4381385..4381564 180..1 900 100 Minus
3L 28110227 3L 4381190..4381327 317..180 690 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4380861..4381127 583..317 1335 100 Minus
3L 28103327 3L 4381385..4381564 180..1 900 100 Minus
3L 28103327 3L 4381190..4381327 317..180 690 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:09:16 has no hits.

GH04494.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:09:54 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4380774..4380952 1..179 100   Minus
chr3L 4380252..4380514 318..580 99 <- Minus
chr3L 4380578..4380715 180..317 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:14:03 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
CG32240-RA 1..438 79..516 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:06:46 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
CG32240-RA 1..438 79..516 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:35 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
CG32240-RA 1..438 79..516 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:56:36 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
CG32240-RA 1..438 79..516 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:28:12 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
CG32240-RA 1..438 79..516 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:26:32 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
CG32240-RA 1..580 1..580 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:06:45 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
CG32240-RA 1..580 1..580 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:35 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
CG32240-RA 66..645 1..580 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:56:37 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
CG32240-RA 1..580 1..580 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:28:12 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
CG32240-RA 66..645 1..580 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:54 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4380864..4381126 318..580 100 <- Minus
3L 4381190..4381327 180..317 100 <- Minus
3L 4381386..4381564 1..179 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:54 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4380864..4381126 318..580 100 <- Minus
3L 4381190..4381327 180..317 100 <- Minus
3L 4381386..4381564 1..179 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:09:54 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4380864..4381126 318..580 100 <- Minus
3L 4381190..4381327 180..317 100 <- Minus
3L 4381386..4381564 1..179 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:35 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4380864..4381126 318..580 100 <- Minus
arm_3L 4381190..4381327 180..317 100 <- Minus
arm_3L 4381386..4381564 1..179 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:29:04 Download gff for GH04494.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4380864..4381126 318..580 100 <- Minus
3L 4381190..4381327 180..317 100 <- Minus
3L 4381386..4381564 1..179 100   Minus

GH04494.hyp Sequence

Translation from 78 to 515

> GH04494.hyp
MMMPQFVFWRRDAKKTQLEQISPIWRDLNATFVTVLSWSWLIYALSALVI
ITCAYFAYCERCRRTESVRRRRVIQRAQERPPQKRRPNAAYRDHQIYRHI
ILSVAKYMKNPDGIRPFIEHMEQLYPLRHNLADQQQVAEPSAGED*

GH04494.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG32240-PA 145 CG32240-PA 1..145 1..145 773 100 Plus

GH04494.pep Sequence

Translation from 78 to 515

> GH04494.pep
MMMPQFVFWRRDAKKTQLEQISPIWRDLNATFVTVLSWSWLIYALSALVI
ITCAYFAYCERCRRTESVRRRRVIQRAQERPPQKRRPNAAYRDHQIYRHI
ILSVAKYMKNPDGIRPFIEHMEQLYPLRHNLADQQQVAEPSAGED*

GH04494.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24734-PA 152 GF24734-PA 1..152 3..145 566 78.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14189-PA 145 GG14189-PA 1..145 1..145 672 92.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15814-PA 145 GH15814-PA 1..131 3..133 512 65.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG32240-PA 145 CG32240-PA 1..145 1..145 773 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12596-PA 149 GI12596-PA 1..142 3..144 480 72.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17953-PA 104 GL17953-PA 1..92 2..90 249 54.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16780-PA 121 GA16780-PA 10..121 12..119 395 66.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13978-PA 145 GM13978-PA 1..145 1..145 757 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13261-PA 145 GD13261-PA 1..145 1..145 755 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12719-PA 148 GJ12719-PA 1..131 3..133 490 74.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:50:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11045-PA 154 GK11045-PA 2..141 6..145 473 71.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:50:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20619-PA 143 GE20619-PA 1..143 3..145 678 95.1 Plus