Clone GH04563 Report

Search the DGRC for GH04563

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:45
Well:63
Vector:pOT2
Associated Gene/TranscriptNPF-RA
Protein status:GH04563.pep: gold
Preliminary Size:788
Sequenced Size:635

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10342 2003-01-01 Sim4 clustering to Release 3
npf 2008-04-29 Release 5.5 accounting
npf 2008-08-15 Release 5.9 accounting
npf 2008-12-18 5.12 accounting

Clone Sequence Records

GH04563.complete Sequence

635 bp (635 high quality bases) assembled on 2005-07-22

GenBank Submission: BT023797

> GH04563.complete
ATACAGTCCGACGAACAATTGCATTGTGACACCGTTGCGCTTTCCAATAC
TCAAACTCCCAGTTGAACCAGAACTATGTGCCAAACAATGCGTTGCATCC
TGGTTGCCTGTGTGGCCCTTGCCCTCCTAGCCGCCGGCTGCCGAGTGGAG
GCGTCCAACTCCAGACCTCCGCGAAAGAACGATGTCAACACTATGGCTGA
TGCCTACAAGTTCCTGCAGGATCTGGACACCTACTACGGCGACAGAGCCC
GCGTTCGGTTCGGAAAGCGCGGATCGCTGATGGATATCCTGAGGAATCAC
GAGATGGACAACATAAATCTAGGAAAAAATGCCAACAATGGAGGAGAATT
TGCTCGCGGTTTTAATGAGGAGGAGATATTCTAAATCCATTTTAGACGAC
CATGGCAACGTCACTAACTCATGATGATAGTTATTAGCATACGCATTTTT
ATTTAAATTGTTTTTCGGGGCAATAGTTTAACGTGCTGGGAAAGAACAAG
TAGTTGCAGCTACAGAAATAAGTATTTACTCTAGTCTTGATGTCGGTTGA
ATAAATGAATTACCCCAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH04563.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
npf-RA 771 npf-RA 167..737 1..571 2855 100 Plus
npf.a 678 npf.a 143..644 70..571 2510 100 Plus
npf.a 678 npf.a 64..134 1..71 355 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12435326..12435608 70..352 1400 99.6 Plus
chr3R 27901430 chr3R 12435663..12435878 354..569 1065 99.5 Plus
chr3R 27901430 chr3R 12434311..12434381 1..71 355 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:31:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16610773..16611055 70..352 1415 100 Plus
3R 32079331 3R 16611108..16611327 352..571 1100 100 Plus
3R 32079331 3R 16609758..16609828 1..71 355 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16351604..16351886 70..352 1415 100 Plus
3R 31820162 3R 16351939..16352158 352..571 1100 100 Plus
3R 31820162 3R 16350589..16350659 1..71 355 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:46:24 has no hits.

GH04563.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:47:03 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12434311..12434381 1..71 100 -> Plus
chr3R 12435328..12435607 72..351 99 -> Plus
chr3R 12435661..12435878 352..569 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:14:35 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
npf-RA 1..309 76..384 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:46:56 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
npf-RA 1..309 76..384 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:40:01 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
npf-RA 1..309 76..384 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:28:36 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
npf-RA 1..309 76..384 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:15:32 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
NPF-RA 1..309 76..384 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:20:23 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
npf-RA 1..568 2..569 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:46:56 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
npf-RA 1..568 2..569 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:40:01 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
npf-RA 1..569 1..569 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:28:37 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
npf-RA 1..568 2..569 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:15:32 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
NPF-RA 1..569 1..569 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:47:03 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16609758..16609828 1..71 100 -> Plus
3R 16610775..16611054 72..351 100 -> Plus
3R 16611108..16611325 352..569 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:47:03 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16609758..16609828 1..71 100 -> Plus
3R 16610775..16611054 72..351 100 -> Plus
3R 16611108..16611325 352..569 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:47:03 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16609758..16609828 1..71 100 -> Plus
3R 16610775..16611054 72..351 100 -> Plus
3R 16611108..16611325 352..569 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:40:01 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12435480..12435550 1..71 100 -> Plus
arm_3R 12436497..12436776 72..351 100 -> Plus
arm_3R 12436830..12437047 352..569 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:07:09 Download gff for GH04563.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16351606..16351885 72..351 100 -> Plus
3R 16351939..16352156 352..569 100   Plus
3R 16350589..16350659 1..71 100 -> Plus

GH04563.pep Sequence

Translation from 75 to 383

> GH04563.pep
MCQTMRCILVACVALALLAAGCRVEASNSRPPRKNDVNTMADAYKFLQDL
DTYYGDRARVRFGKRGSLMDILRNHEMDNINLGKNANNGGEFARGFNEEE
IF*

GH04563.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17058-PA 103 GF17058-PA 1..103 1..102 435 78.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21709-PA 102 GG21709-PA 1..102 1..102 428 91.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20253-PA 107 GH20253-PA 1..107 1..102 284 57 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:25
Subject Length Description Subject Range Query Range Score Percent Strand
NPF-PC 102 CG10342-PC 1..102 1..102 537 100 Plus
NPF-PB 102 CG10342-PB 1..102 1..102 537 100 Plus
NPF-PA 102 CG10342-PA 1..102 1..102 537 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22361-PA 105 GI22361-PA 1..105 1..102 321 61.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27189-PA 102 GL27189-PA 1..102 1..102 404 74.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:42:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10258-PA 102 GA10258-PA 1..102 1..102 404 74.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:42:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15171-PA 98 GM15171-PA 1..98 5..102 430 95.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19113-PA 102 GD19113-PA 1..102 1..102 520 96.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24394-PA 106 GJ24394-PA 1..106 1..102 335 64.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22327-PA 101 GK22327-PA 1..98 1..100 328 64 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24580-PA 98 GE24580-PA 1..98 5..102 481 91.8 Plus

GH04563.hyp Sequence

Translation from 75 to 383

> GH04563.hyp
MCQTMRCILVACVALALLAAGCRVEASNSRPPRKNDVNTMADAYKFLQDL
DTYYGDRARVRFGKRGSLMDILRNHEMDNINLGKNANNGGEFARGFNEEE
IF*

GH04563.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
NPF-PC 102 CG10342-PC 1..102 1..102 537 100 Plus
NPF-PB 102 CG10342-PB 1..102 1..102 537 100 Plus
NPF-PA 102 CG10342-PA 1..102 1..102 537 100 Plus