BDGP Sequence Production Resources |
Search the DGRC for GH04563
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 45 |
Well: | 63 |
Vector: | pOT2 |
Associated Gene/Transcript | NPF-RA |
Protein status: | GH04563.pep: gold |
Preliminary Size: | 788 |
Sequenced Size: | 635 |
Gene | Date | Evidence |
---|---|---|
CG10342 | 2003-01-01 | Sim4 clustering to Release 3 |
npf | 2008-04-29 | Release 5.5 accounting |
npf | 2008-08-15 | Release 5.9 accounting |
npf | 2008-12-18 | 5.12 accounting |
635 bp (635 high quality bases) assembled on 2005-07-22
GenBank Submission: BT023797
> GH04563.complete ATACAGTCCGACGAACAATTGCATTGTGACACCGTTGCGCTTTCCAATAC TCAAACTCCCAGTTGAACCAGAACTATGTGCCAAACAATGCGTTGCATCC TGGTTGCCTGTGTGGCCCTTGCCCTCCTAGCCGCCGGCTGCCGAGTGGAG GCGTCCAACTCCAGACCTCCGCGAAAGAACGATGTCAACACTATGGCTGA TGCCTACAAGTTCCTGCAGGATCTGGACACCTACTACGGCGACAGAGCCC GCGTTCGGTTCGGAAAGCGCGGATCGCTGATGGATATCCTGAGGAATCAC GAGATGGACAACATAAATCTAGGAAAAAATGCCAACAATGGAGGAGAATT TGCTCGCGGTTTTAATGAGGAGGAGATATTCTAAATCCATTTTAGACGAC CATGGCAACGTCACTAACTCATGATGATAGTTATTAGCATACGCATTTTT ATTTAAATTGTTTTTCGGGGCAATAGTTTAACGTGCTGGGAAAGAACAAG TAGTTGCAGCTACAGAAATAAGTATTTACTCTAGTCTTGATGTCGGTTGA ATAAATGAATTACCCCAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 12435326..12435608 | 70..352 | 1400 | 99.6 | Plus |
chr3R | 27901430 | chr3R | 12435663..12435878 | 354..569 | 1065 | 99.5 | Plus |
chr3R | 27901430 | chr3R | 12434311..12434381 | 1..71 | 355 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 16351604..16351886 | 70..352 | 1415 | 100 | Plus |
3R | 31820162 | 3R | 16351939..16352158 | 352..571 | 1100 | 100 | Plus |
3R | 31820162 | 3R | 16350589..16350659 | 1..71 | 355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 12434311..12434381 | 1..71 | 100 | -> | Plus |
chr3R | 12435328..12435607 | 72..351 | 99 | -> | Plus |
chr3R | 12435661..12435878 | 352..569 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
npf-RA | 1..309 | 76..384 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
npf-RA | 1..309 | 76..384 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
npf-RA | 1..309 | 76..384 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
npf-RA | 1..309 | 76..384 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NPF-RA | 1..309 | 76..384 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
npf-RA | 1..568 | 2..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
npf-RA | 1..568 | 2..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
npf-RA | 1..569 | 1..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
npf-RA | 1..568 | 2..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NPF-RA | 1..569 | 1..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16609758..16609828 | 1..71 | 100 | -> | Plus |
3R | 16610775..16611054 | 72..351 | 100 | -> | Plus |
3R | 16611108..16611325 | 352..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16609758..16609828 | 1..71 | 100 | -> | Plus |
3R | 16610775..16611054 | 72..351 | 100 | -> | Plus |
3R | 16611108..16611325 | 352..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16609758..16609828 | 1..71 | 100 | -> | Plus |
3R | 16610775..16611054 | 72..351 | 100 | -> | Plus |
3R | 16611108..16611325 | 352..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 12435480..12435550 | 1..71 | 100 | -> | Plus |
arm_3R | 12436497..12436776 | 72..351 | 100 | -> | Plus |
arm_3R | 12436830..12437047 | 352..569 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 16351606..16351885 | 72..351 | 100 | -> | Plus |
3R | 16351939..16352156 | 352..569 | 100 | Plus | |
3R | 16350589..16350659 | 1..71 | 100 | -> | Plus |
Translation from 75 to 383
> GH04563.pep MCQTMRCILVACVALALLAAGCRVEASNSRPPRKNDVNTMADAYKFLQDL DTYYGDRARVRFGKRGSLMDILRNHEMDNINLGKNANNGGEFARGFNEEE IF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17058-PA | 103 | GF17058-PA | 1..103 | 1..102 | 435 | 78.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21709-PA | 102 | GG21709-PA | 1..102 | 1..102 | 428 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20253-PA | 107 | GH20253-PA | 1..107 | 1..102 | 284 | 57 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
NPF-PC | 102 | CG10342-PC | 1..102 | 1..102 | 537 | 100 | Plus |
NPF-PB | 102 | CG10342-PB | 1..102 | 1..102 | 537 | 100 | Plus |
NPF-PA | 102 | CG10342-PA | 1..102 | 1..102 | 537 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22361-PA | 105 | GI22361-PA | 1..105 | 1..102 | 321 | 61.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL27189-PA | 102 | GL27189-PA | 1..102 | 1..102 | 404 | 74.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10258-PA | 102 | GA10258-PA | 1..102 | 1..102 | 404 | 74.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15171-PA | 98 | GM15171-PA | 1..98 | 5..102 | 430 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19113-PA | 102 | GD19113-PA | 1..102 | 1..102 | 520 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24394-PA | 106 | GJ24394-PA | 1..106 | 1..102 | 335 | 64.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22327-PA | 101 | GK22327-PA | 1..98 | 1..100 | 328 | 64 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24580-PA | 98 | GE24580-PA | 1..98 | 5..102 | 481 | 91.8 | Plus |
Translation from 75 to 383
> GH04563.hyp MCQTMRCILVACVALALLAAGCRVEASNSRPPRKNDVNTMADAYKFLQDL DTYYGDRARVRFGKRGSLMDILRNHEMDNINLGKNANNGGEFARGFNEEE IF*