Clone GH04581 Report

Search the DGRC for GH04581

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:45
Well:81
Vector:pOT2
Associated Gene/TranscriptCG17059-RA
Protein status:GH04581.pep: gold
Preliminary Size:385
Sequenced Size:400

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17059 2002-01-01 Sim4 clustering to Release 2
CG17059 2002-05-18 Blastp of sequenced clone
CG17059 2003-01-01 Sim4 clustering to Release 3
CG17059 2008-04-29 Release 5.5 accounting
CG17059 2008-08-15 Release 5.9 accounting
CG17059 2008-12-18 5.12 accounting

Clone Sequence Records

GH04581.complete Sequence

400 bp (400 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118736

> GH04581.complete
CTGCGCTAAAAAAAATAACAAAAAAGATAATTGGAAGCTAAAATAGAAAT
AAGTATGGATTTAAACATGAAACCGTCTCTGGCTGCCGACGAAATGTTTT
CCGAAGGCCCCGGCTACATGGAAATGGACGAGTCCGGCGGAGCCACAGGA
ATGATGATGGACCACCTGCCCTCCAACGATAAGCACGTCCACGCTGACTT
CTACAATGATTTTGATGATCTGTTCGATGAAGACAACTGGGCCAAGATGA
AAACCGATGGGAAACAGTAGAGGCCACCACGCAATAAATGGATTGAAAGA
TTTGTATTCGCGACTCGTTCTTCTGTCTGTAATTTTACTTGCACAATCAG
CGATCATTGGTGTATAAAAAATTGCTTCAACTAAAAAAAAAAAAAAAAAA

GH04581.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG17059-RA 449 CG17059-RA 34..416 1..383 1915 100 Plus
Fsn-RB 1317 Fsn-RB 1212..1317 383..278 530 100 Minus
Fsn.a 1347 Fsn.a 1242..1347 383..278 530 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9108108..9108359 131..382 1260 100 Plus
chr2R 21145070 chr2R 9107655..9107778 9..132 605 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:31:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13220764..13221016 131..383 1265 100 Plus
2R 25286936 2R 13220324..13220455 1..132 660 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13221963..13222215 131..383 1265 100 Plus
2R 25260384 2R 13221523..13221654 1..132 660 100 Plus
Blast to na_te.dros performed 2019-03-16 14:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dm88 4558 Dm88 DM88 4558bp 4199..4256 18..72 102 71.2 Plus

GH04581.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:58:19 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9107648..9107778 1..132 98 -> Plus
chr2R 9108110..9108359 133..382 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:14:40 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
CG17059-RA 1..216 55..270 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:49 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
CG17059-RA 1..216 55..270 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:02:41 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
CG17059-RA 1..216 55..270 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:39:07 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
CG17059-RA 1..216 55..270 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:34:57 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
CG17059-RA 1..216 55..270 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:22:36 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
CG17059-RA 1..382 1..382 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:49 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
CG17059-RA 1..382 1..382 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:02:41 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
CG17059-RA 42..423 1..382 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:39:07 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
CG17059-RA 1..382 1..382 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:34:57 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
CG17059-RA 42..423 1..382 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:58:19 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13220324..13220455 1..132 100 -> Plus
2R 13220766..13221015 133..382 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:58:19 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13220324..13220455 1..132 100 -> Plus
2R 13220766..13221015 133..382 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:58:19 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13220324..13220455 1..132 100 -> Plus
2R 13220766..13221015 133..382 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:02:41 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9107829..9107960 1..132 100 -> Plus
arm_2R 9108271..9108520 133..382 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:11:30 Download gff for GH04581.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13221965..13222214 133..382 100   Plus
2R 13221523..13221654 1..132 100 -> Plus

GH04581.hyp Sequence

Translation from 54 to 269

> GH04581.hyp
MDLNMKPSLAADEMFSEGPGYMEMDESGGATGMMMDHLPSNDKHVHADFY
NDFDDLFDEDNWAKMKTDGKQ*

GH04581.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG17059-PA 71 CG17059-PA 1..71 1..71 392 100 Plus

GH04581.pep Sequence

Translation from 54 to 269

> GH04581.pep
MDLNMKPSLAADEMFSEGPGYMEMDESGGATGMMMDHLPSNDKHVHADFY
NDFDDLFDEDNWAKMKTDGKQ*

GH04581.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11947-PA 72 GF11947-PA 1..68 1..69 318 91.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20365-PA 71 GG20365-PA 1..71 1..71 279 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22821-PA 77 GH22821-PA 1..72 1..69 208 68.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG17059-PA 71 CG17059-PA 1..71 1..71 392 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21196-PA 77 GI21196-PA 1..72 1..69 209 68.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11557-PA 74 GL11557-PA 1..69 1..69 273 91.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14303-PA 74 GA14303-PA 1..69 1..69 273 91.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21453-PA 71 GM21453-PA 1..71 1..71 359 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10951-PA 71 GD10951-PA 1..71 1..71 362 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20800-PA 77 GJ20800-PA 1..69 1..66 202 68.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21323-PA 73 GK21323-PA 1..66 1..66 241 90.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12525-PA 71 GE12525-PA 1..71 1..71 356 97.2 Plus