BDGP Sequence Production Resources |
Search the DGRC for GH04581
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 45 |
Well: | 81 |
Vector: | pOT2 |
Associated Gene/Transcript | CG17059-RA |
Protein status: | GH04581.pep: gold |
Preliminary Size: | 385 |
Sequenced Size: | 400 |
Gene | Date | Evidence |
---|---|---|
CG17059 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17059 | 2002-05-18 | Blastp of sequenced clone |
CG17059 | 2003-01-01 | Sim4 clustering to Release 3 |
CG17059 | 2008-04-29 | Release 5.5 accounting |
CG17059 | 2008-08-15 | Release 5.9 accounting |
CG17059 | 2008-12-18 | 5.12 accounting |
400 bp (400 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118736
> GH04581.complete CTGCGCTAAAAAAAATAACAAAAAAGATAATTGGAAGCTAAAATAGAAAT AAGTATGGATTTAAACATGAAACCGTCTCTGGCTGCCGACGAAATGTTTT CCGAAGGCCCCGGCTACATGGAAATGGACGAGTCCGGCGGAGCCACAGGA ATGATGATGGACCACCTGCCCTCCAACGATAAGCACGTCCACGCTGACTT CTACAATGATTTTGATGATCTGTTCGATGAAGACAACTGGGCCAAGATGA AAACCGATGGGAAACAGTAGAGGCCACCACGCAATAAATGGATTGAAAGA TTTGTATTCGCGACTCGTTCTTCTGTCTGTAATTTTACTTGCACAATCAG CGATCATTGGTGTATAAAAAATTGCTTCAACTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dm88 | 4558 | Dm88 DM88 4558bp | 4199..4256 | 18..72 | 102 | 71.2 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 9107648..9107778 | 1..132 | 98 | -> | Plus |
chr2R | 9108110..9108359 | 133..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17059-RA | 1..216 | 55..270 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17059-RA | 1..216 | 55..270 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17059-RA | 1..216 | 55..270 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17059-RA | 1..216 | 55..270 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17059-RA | 1..216 | 55..270 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17059-RA | 1..382 | 1..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17059-RA | 1..382 | 1..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17059-RA | 42..423 | 1..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17059-RA | 1..382 | 1..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17059-RA | 42..423 | 1..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13220324..13220455 | 1..132 | 100 | -> | Plus |
2R | 13220766..13221015 | 133..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13220324..13220455 | 1..132 | 100 | -> | Plus |
2R | 13220766..13221015 | 133..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13220324..13220455 | 1..132 | 100 | -> | Plus |
2R | 13220766..13221015 | 133..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 9107829..9107960 | 1..132 | 100 | -> | Plus |
arm_2R | 9108271..9108520 | 133..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 13221965..13222214 | 133..382 | 100 | Plus | |
2R | 13221523..13221654 | 1..132 | 100 | -> | Plus |
Translation from 54 to 269
> GH04581.hyp MDLNMKPSLAADEMFSEGPGYMEMDESGGATGMMMDHLPSNDKHVHADFY NDFDDLFDEDNWAKMKTDGKQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17059-PA | 71 | CG17059-PA | 1..71 | 1..71 | 392 | 100 | Plus |
Translation from 54 to 269
> GH04581.pep MDLNMKPSLAADEMFSEGPGYMEMDESGGATGMMMDHLPSNDKHVHADFY NDFDDLFDEDNWAKMKTDGKQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11947-PA | 72 | GF11947-PA | 1..68 | 1..69 | 318 | 91.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20365-PA | 71 | GG20365-PA | 1..71 | 1..71 | 279 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22821-PA | 77 | GH22821-PA | 1..72 | 1..69 | 208 | 68.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17059-PA | 71 | CG17059-PA | 1..71 | 1..71 | 392 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21196-PA | 77 | GI21196-PA | 1..72 | 1..69 | 209 | 68.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11557-PA | 74 | GL11557-PA | 1..69 | 1..69 | 273 | 91.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14303-PA | 74 | GA14303-PA | 1..69 | 1..69 | 273 | 91.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21453-PA | 71 | GM21453-PA | 1..71 | 1..71 | 359 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10951-PA | 71 | GD10951-PA | 1..71 | 1..71 | 362 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20800-PA | 77 | GJ20800-PA | 1..69 | 1..66 | 202 | 68.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21323-PA | 73 | GK21323-PA | 1..66 | 1..66 | 241 | 90.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12525-PA | 71 | GE12525-PA | 1..71 | 1..71 | 356 | 97.2 | Plus |