Clone GH04604 Report

Search the DGRC for GH04604

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:46
Well:4
Vector:pOT2
Associated Gene/Transcriptcype-RA
Protein status:GH04604.pep: gold
Preliminary Size:383
Sequenced Size:401

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14028 2002-01-01 Sim4 clustering to Release 2
CG14028 2002-05-18 Blastp of sequenced clone
CG14028 2003-01-01 Sim4 clustering to Release 3
cype 2008-04-29 Release 5.5 accounting
cype 2008-08-15 Release 5.9 accounting
cype 2008-12-18 5.12 accounting

Clone Sequence Records

GH04604.complete Sequence

401 bp assembled on 2006-11-09

GenBank Submission: AY118737

> GH04604.complete
ATTTGTTTTAGGTTCCATCTCTATCTCAGATTCTGAATTTGCAAATCGAC
ATGGCCAACACTCCAGCCACCTCCTCTGCCGGACCCGTGCTCCGTGGCCT
CCACAATGCCACCATCAAGCGCAACCTGGCCGTTTCCCTGGGCCTGACCG
CCGTGGTGACCATCGCCTACAAAATTCTGGTCAACGATCCCAAGAAGGCC
GCCTACGCCGACTTCTACTCGAAGTACGATGCCAACAAGTCCTTCGAGCG
CATGAAGGCCGCCGGTCGTTTCCAGTCCTGCTAGGCTATGTTATCCCAAA
ACACAAGTAGTCTAAGTCAAATGATGTTGTAGAACAAGAGTTGCGCTTCT
GTATTGAAAACTAAATAGATTTCAGTCTACGTAAAAAAAAAAAAAAAAAA
A

GH04604.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
cype-RA 618 cype-RA 49..431 1..383 1915 100 Plus
cype.a 618 cype.a 121..461 43..383 1690 99.7 Plus
cype.a 618 cype.a 15..60 1..46 230 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:56:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5326602..5326776 47..221 875 100 Plus
chr2L 23010047 chr2L 5326843..5327004 221..382 810 100 Plus
chr2L 23010047 chr2L 5326340..5326385 1..46 230 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:31:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:56:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5327503..5327677 47..221 875 100 Plus
2L 23513712 2L 5327744..5327906 221..383 815 100 Plus
2L 23513712 2L 5327241..5327286 1..46 230 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5327503..5327677 47..221 875 100 Plus
2L 23513712 2L 5327744..5327906 221..383 815 100 Plus
2L 23513712 2L 5327241..5327286 1..46 230 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:56:25 has no hits.

GH04604.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:57:10 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5326340..5326385 1..46 100 -> Plus
chr2L 5326602..5326775 47..220 100 -> Plus
chr2L 5326843..5327004 221..382 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:14:44 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
cype-RA 1..234 51..284 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:44:10 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
cype-RA 1..234 51..284 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:48 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
cype-RA 1..234 51..284 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:53 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
cype-RA 1..234 51..284 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:55:58 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
cype-RA 1..234 51..284 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:52:06 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
cype-RA 1..382 1..382 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:44:10 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
cype-RA 1..382 1..382 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:48 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
cype-RA 15..396 1..382 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:53 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
cype-RA 1..382 1..382 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:55:58 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
cype-RA 15..396 1..382 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:57:10 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5327241..5327286 1..46 100 -> Plus
2L 5327503..5327676 47..220 100 -> Plus
2L 5327744..5327905 221..382 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:57:10 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5327241..5327286 1..46 100 -> Plus
2L 5327503..5327676 47..220 100 -> Plus
2L 5327744..5327905 221..382 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:57:10 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5327241..5327286 1..46 100 -> Plus
2L 5327503..5327676 47..220 100 -> Plus
2L 5327744..5327905 221..382 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:48 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5327241..5327286 1..46 100 -> Plus
arm_2L 5327503..5327676 47..220 100 -> Plus
arm_2L 5327744..5327905 221..382 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:57:59 Download gff for GH04604.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5327241..5327286 1..46 100 -> Plus
2L 5327503..5327676 47..220 100 -> Plus
2L 5327744..5327905 221..382 100   Plus

GH04604.hyp Sequence

Translation from 1 to 309

> GH04604.hyp
FVLGSISISDSEFANRHGQHSSHLLCRTRAPWPPQCHHQAQPGRFPGPDR
RGDHRLQNSGQRSQEGRLRRLLLEVRCQQVLRAHEGRRSFPVLLGYVIPK
HK*
Sequence GH04604.hyp has no blast hits.

GH04604.pep Sequence

Translation from 50 to 283

> GH04604.pep
MANTPATSSAGPVLRGLHNATIKRNLAVSLGLTAVVTIAYKILVNDPKKA
AYADFYSKYDANKSFERMKAAGRFQSC*

GH04604.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14388-PA 78 GF14388-PA 1..78 1..77 367 88.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25067-PA 77 GG25067-PA 1..77 1..77 394 96.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13384-PA 78 GH13384-PA 1..78 1..77 358 85.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
cype-PC 77 CG14028-PC 1..77 1..77 388 100 Plus
cype-PB 77 CG14028-PB 1..77 1..77 388 100 Plus
cype-PA 77 CG14028-PA 1..77 1..77 388 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17627-PA 78 GI17627-PA 1..78 1..77 372 91 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19570-PA 80 GL19570-PA 14..80 11..77 331 88.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12710-PA 80 GA12710-PA 14..80 11..77 331 88.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18546-PA 836 GM18546-PA 1..69 1..67 293 85.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17541-PA 78 GJ17541-PA 1..78 1..77 370 89.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18375-PA 78 GK18375-PA 1..78 1..77 373 91 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25385-PA 77 GE25385-PA 1..77 1..77 394 96.1 Plus