BDGP Sequence Production Resources |
Search the DGRC for GH04604
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 46 |
Well: | 4 |
Vector: | pOT2 |
Associated Gene/Transcript | cype-RA |
Protein status: | GH04604.pep: gold |
Preliminary Size: | 383 |
Sequenced Size: | 401 |
Gene | Date | Evidence |
---|---|---|
CG14028 | 2002-01-01 | Sim4 clustering to Release 2 |
CG14028 | 2002-05-18 | Blastp of sequenced clone |
CG14028 | 2003-01-01 | Sim4 clustering to Release 3 |
cype | 2008-04-29 | Release 5.5 accounting |
cype | 2008-08-15 | Release 5.9 accounting |
cype | 2008-12-18 | 5.12 accounting |
401 bp assembled on 2006-11-09
GenBank Submission: AY118737
> GH04604.complete ATTTGTTTTAGGTTCCATCTCTATCTCAGATTCTGAATTTGCAAATCGAC ATGGCCAACACTCCAGCCACCTCCTCTGCCGGACCCGTGCTCCGTGGCCT CCACAATGCCACCATCAAGCGCAACCTGGCCGTTTCCCTGGGCCTGACCG CCGTGGTGACCATCGCCTACAAAATTCTGGTCAACGATCCCAAGAAGGCC GCCTACGCCGACTTCTACTCGAAGTACGATGCCAACAAGTCCTTCGAGCG CATGAAGGCCGCCGGTCGTTTCCAGTCCTGCTAGGCTATGTTATCCCAAA ACACAAGTAGTCTAAGTCAAATGATGTTGTAGAACAAGAGTTGCGCTTCT GTATTGAAAACTAAATAGATTTCAGTCTACGTAAAAAAAAAAAAAAAAAA A
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 5326602..5326776 | 47..221 | 875 | 100 | Plus |
chr2L | 23010047 | chr2L | 5326843..5327004 | 221..382 | 810 | 100 | Plus |
chr2L | 23010047 | chr2L | 5326340..5326385 | 1..46 | 230 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 5326340..5326385 | 1..46 | 100 | -> | Plus |
chr2L | 5326602..5326775 | 47..220 | 100 | -> | Plus |
chr2L | 5326843..5327004 | 221..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
cype-RA | 1..234 | 51..284 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
cype-RA | 1..234 | 51..284 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
cype-RA | 1..234 | 51..284 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
cype-RA | 1..234 | 51..284 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
cype-RA | 1..234 | 51..284 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
cype-RA | 1..382 | 1..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
cype-RA | 1..382 | 1..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
cype-RA | 15..396 | 1..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
cype-RA | 1..382 | 1..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
cype-RA | 15..396 | 1..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5327241..5327286 | 1..46 | 100 | -> | Plus |
2L | 5327503..5327676 | 47..220 | 100 | -> | Plus |
2L | 5327744..5327905 | 221..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5327241..5327286 | 1..46 | 100 | -> | Plus |
2L | 5327503..5327676 | 47..220 | 100 | -> | Plus |
2L | 5327744..5327905 | 221..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5327241..5327286 | 1..46 | 100 | -> | Plus |
2L | 5327503..5327676 | 47..220 | 100 | -> | Plus |
2L | 5327744..5327905 | 221..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 5327241..5327286 | 1..46 | 100 | -> | Plus |
arm_2L | 5327503..5327676 | 47..220 | 100 | -> | Plus |
arm_2L | 5327744..5327905 | 221..382 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5327241..5327286 | 1..46 | 100 | -> | Plus |
2L | 5327503..5327676 | 47..220 | 100 | -> | Plus |
2L | 5327744..5327905 | 221..382 | 100 | Plus |
Translation from 1 to 309
> GH04604.hyp FVLGSISISDSEFANRHGQHSSHLLCRTRAPWPPQCHHQAQPGRFPGPDR RGDHRLQNSGQRSQEGRLRRLLLEVRCQQVLRAHEGRRSFPVLLGYVIPK HK*
Translation from 50 to 283
> GH04604.pep MANTPATSSAGPVLRGLHNATIKRNLAVSLGLTAVVTIAYKILVNDPKKA AYADFYSKYDANKSFERMKAAGRFQSC*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14388-PA | 78 | GF14388-PA | 1..78 | 1..77 | 367 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG25067-PA | 77 | GG25067-PA | 1..77 | 1..77 | 394 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13384-PA | 78 | GH13384-PA | 1..78 | 1..77 | 358 | 85.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
cype-PC | 77 | CG14028-PC | 1..77 | 1..77 | 388 | 100 | Plus |
cype-PB | 77 | CG14028-PB | 1..77 | 1..77 | 388 | 100 | Plus |
cype-PA | 77 | CG14028-PA | 1..77 | 1..77 | 388 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17627-PA | 78 | GI17627-PA | 1..78 | 1..77 | 372 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19570-PA | 80 | GL19570-PA | 14..80 | 11..77 | 331 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12710-PA | 80 | GA12710-PA | 14..80 | 11..77 | 331 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18546-PA | 836 | GM18546-PA | 1..69 | 1..67 | 293 | 85.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17541-PA | 78 | GJ17541-PA | 1..78 | 1..77 | 370 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18375-PA | 78 | GK18375-PA | 1..78 | 1..77 | 373 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25385-PA | 77 | GE25385-PA | 1..77 | 1..77 | 394 | 96.1 | Plus |